Property Summary

NCBI Gene PubMed Count 29
PubMed Score 49.90
PubTator Score 56.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Guillain-Barre syndrome 14 3.779 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 3.7e-02
interstitial cystitis 1.200 5.5e-03
mucosa-associated lymphoid tissue lympho... 1.804 4.8e-02
osteosarcoma -2.104 1.1e-04
psoriasis 1.400 1.4e-18
tuberculosis 2.200 8.8e-08

Gene RIF (20)

AA Sequence

MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGN      1 - 70
DISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLS     71 - 140
VNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQH    141 - 210
HGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDS    211 - 280
NPPARLSWTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSG    281 - 350
VLLGAVGGAGATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPR    351 - 420
HHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK                           421 - 467
//

Text Mined References (32)

PMID Year Title