Property Summary

NCBI Gene PubMed Count 28
Grant Count 1
Funding $7,218.75
PubMed Score 46.07
PubTator Score 56.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.037
osteosarcoma -2.104 0.000
tuberculosis 2.200 0.000
interstitial cystitis 1.200 0.005
mucosa-associated lymphoid tissue lympho... 1.804 0.048
psoriasis 1.400 0.000

Synonym

Accession Q9Y286 Q9NZQ1 Q9UJ86 Q9UJ87 Q9Y502 Siglec-7
Symbols p75
QA79
AIRM1
CD328
CDw328
D-siglec
SIGLEC-7
SIGLECP2
SIGLEC19P
p75/AIRM1

Gene

 Grant Application (1)

PDB

1NKO   1O7S   1O7V   2DF3   2G5R   2HRL  

Gene RIF (19)

PMID Text
24810846 Siglec-7 plays a significant role in inhibiting IgE-mediated mast cell activation, but only moderately affects IgE-mediated activation in primary human basophils.
24569453 Expression of Siglec-7 and -9 ligands was associated with susceptibility of NK cell-sensitive tumor cells and, unexpectedly, of presumably NK cell-resistant tumor cells to NK cell-mediated cytotoxicity.
24330394 These results show that Siglec-7 binds HIV-1 via gp120 and contributes to enhance the susceptibility to infection of CD4 positive T cells and monocyte-derived macrophages.
24330394 SIGLEC7 binds to HIV-1 gp120 and enhances HIV-1 infection of CD4+ T cells
23029261 Siglec-7 participates in generating a monocyte-mediated inflammatory outcome following pathogen recognition.
22933622 Based on upregulated SIGLEC7 expression in blood monocytes during relapse, findings suggest a role for SIGLEC7 in acute disease activity in multiple sclerosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19710502 The decreased expression of Siglec-7 represents an early marker of dysfunctional natural killer-cell subsets associated with high levels of HIV-1 viremia.
18331725 The species-specific differences in the expression expression of Siglecs in SIV infection was studied.
16828866 The expression levels of Siglec-7 were detectable in bone marrow plasma from AML patients and serum from normal donors.
More...

AA Sequence

MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGN      1 - 70
DISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLS     71 - 140
VNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQH    141 - 210
HGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTASTALGNSSSLSVLEGQSLRLVCAVDS    211 - 280
NPPARLSWTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQEYTGKMRPVSG    281 - 350
VLLGAVGGAGATALVFLSFCVIFIVVRSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPR    351 - 420
HHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIPK                           421 - 467
//

Text Mined References (31)

PMID Year Title
24810846 2014 Siglec-7 is an inhibitory receptor on human mast cells and basophils.
24569453 2014 Interactions between Siglec-7/9 receptors and ligands influence NK cell-dependent tumor immunosurveillance.
24330394 2013 Sialic acid-binding Ig-like lectin-7 interacts with HIV-1 gp120 and facilitates infection of CD4pos T cells and macrophages.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23029261 2012 Engagement of Siglec-7 receptor induces a pro-inflammatory response selectively in monocytes.
22933622 2013 SIGLEC1 and SIGLEC7 expression in circulating monocytes of patients with multiple sclerosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19710502 2009 The decreased expression of Siglec-7 represents an early marker of dysfunctional natural killer-cell subsets associated with high levels of HIV-1 viremia.
18331725 Differences in the constitutive and SIV infection induced expression of Siglecs by hematopoietic cells from non-human primates.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...