Property Summary

NCBI Gene PubMed Count 19
PubMed Score 614.47
PubTator Score 4.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.300 2.0e-03
osteosarcoma -1.051 1.1e-03
psoriasis 1.200 5.4e-04
subependymal giant cell astrocytoma -1.488 3.3e-02
tuberculosis and treatment for 6 months -1.300 3.0e-05

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEVIEAELRSTKHWELTAEGEEI      1 - 70
AREGSHEARVFRSIPPEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRL     71 - 140
QLVRGGQAEKLGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSGSWRDRPFKPY    141 - 210
NFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLR    211 - 280
DPAEALQLPMDYVQRVKRTHSQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKY    281 - 350
FSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVF    351 - 420
SYHQGLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDS    421 - 490
PLCRLDAEPRPPPTQEAA                                                        491 - 508
//

Text Mined References (27)

PMID Year Title