Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.08
PubTator Score 5.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 9.0e-06
Breast cancer 2.400 4.2e-02
cutaneous lupus erythematosus -1.100 7.8e-03
diabetes mellitus -1.100 3.9e-03
ependymoma 1.100 1.9e-11
lung cancer 1.600 1.1e-04
Multiple myeloma 1.587 1.5e-03
osteosarcoma 1.308 2.2e-06
ovarian cancer 1.500 2.0e-03
Rheumatoid arthritis -1.200 1.9e-02
sonic hedgehog group medulloblastoma 1.300 1.2e-07

Gene RIF (6)

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI      1 - 70
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD     71 - 140
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV    141 - 210
AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV    211 - 280
KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA    281 - 350
IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT                                         351 - 383
//

Text Mined References (23)

PMID Year Title