Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.45
PubTator Score 5.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.019
Multiple myeloma 1.587 0.002
cutaneous lupus erythematosus -1.100 0.008
osteosarcoma 1.308 0.000
posterior fossa group B ependymoma 1.300 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
lung cancer 1.600 0.000
diabetes mellitus -1.100 0.004
Breast cancer 2.400 0.042
sonic hedgehog group medulloblastoma 1.300 0.000
ovarian cancer 1.500 0.002

Synonym

Accession Q9Y282 Q5JWS3 Q6ZWP7 Q9H276 Q9P1L3
Symbols Erv46
CGI-54
PRO0989
C20orf47
NY-BR-84
SDBCAG84
dJ477O4.2

Gene

Gene RIF (5)

PMID Text
26177443 Results showed that miR-203a downregulation induced ERGIC3 overexpression in non-small cell lung cancer cells.
23374247 ERGIC3 may play an active role in the development and progression of lung cancer.
23212913 miR-490-3p modulates cell growth and epithelial to mesenchymal transition of hepatocellular carcinoma cells by targeting endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).
22190034 HIV-1 gp160 is identified to have a physical interaction with ERGIC and golgi 3 (ERGIC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17020792 Plays important roles in cell growth and endoplasmic reticulum stress-induced cell death.

AA Sequence

MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI      1 - 70
NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD     71 - 140
RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV    141 - 210
AGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFV    211 - 280
KVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA    281 - 350
IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT                                         351 - 383
//

Text Mined References (23)

PMID Year Title
26177443 2015 ERGIC3, which is regulated by miR-203a, is a potential biomarker for non-small cell lung cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23374247 2013 Suppression subtractive hybridization identified differentially expressed genes in lung adenocarcinoma: ERGIC3 as a novel lung cancer-related gene.
23212913 2013 miR-490-3p modulates cell growth and epithelial to mesenchymal transition of hepatocellular carcinoma cells by targeting endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19946888 2010 Defining the membrane proteome of NK cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17020792 2007 Identification and characterization of endoplasmic reticulum-associated protein, ERp43.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.