Property Summary

NCBI Gene PubMed Count 41
PubMed Score 29.34
PubTator Score 23.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.178 4.4e-02
Atopic dermatitis -1.100 4.6e-04
Breast cancer -1.900 3.2e-11
breast carcinoma -1.200 2.0e-04
ductal carcinoma in situ -1.800 8.8e-04
fibroadenoma -1.200 2.5e-02
hereditary spastic paraplegia -1.399 5.1e-03
interstitial lung disease -1.300 1.8e-02
intraductal papillary-mucinous adenoma (... -1.500 6.3e-03
intraductal papillary-mucinous carcinoma... -1.900 1.6e-03
intraductal papillary-mucinous neoplasm ... -1.800 3.5e-02
invasive ductal carcinoma -2.600 5.9e-04
lung adenocarcinoma -1.300 1.9e-16
non-small cell lung cancer -1.822 8.5e-26
osteosarcoma 1.152 1.8e-02
ovarian cancer -2.700 6.6e-11
pancreatic ductal adenocarcinoma liver m... -3.114 5.4e-04
spina bifida -1.275 3.7e-02
tuberculosis 1.300 7.1e-04

 GO Function (1)

Gene RIF (25)

AA Sequence

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS      1 - 70
FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL     71 - 140
DDIKDRSTLGEKLGGNVVVSLEGKPL                                                141 - 166
//

Text Mined References (49)

PMID Year Title