Property Summary

NCBI Gene PubMed Count 38
Grant Count 7
Funding $404,363.5
PubMed Score 27.63
PubTator Score 23.19

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (25)

PMID Text
26996939 analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover
25814227 Cofilin 2 phosphorylation and genetic overexpression plays a role in the pathogenesis of idiopathic dilated cardiomyopthay.
25502766 The serum lever of Alzheimer's disease were increase and the expression of clf2 strongly correlated with the Mini-Mental State Examination scores of the AD patients
24889065 In primary tumours, both desmin and CFL2 expression predicted improved overall survival in multivariate analyses
24610938 patients with severe nemaline myopathy should be screened for mutations in CFL2.
24023293 study investigated the comparison of the levels of cofilin-1 and cofilin-2 in regressive QR-32 and progressive QRsP-11cells by western blotting
23395798 Studies indicate that cofilin binds actin stoichiometrically - one cofilin molecule per actin filament subunit.
23294842 The N-terminal leucine-rich repeat fragment of Slit2 inhibits HIV-1 gp120-induced phosphorylation of both LIMK1 and cofilin
22560515 A novel homozygous missense mutation in exon 2 (c.19G>A, p.Val7Met) of CFL2 was identified in two siblings with congenital myopathy.
22450169 cofilins 1 and 2 only weakly interact with 14-3-3 and therefore cannot directly compete with phosphorylated small heat shock protein HspB6 for its binding to 14-3-3 zeta
More...

AA Sequence

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS      1 - 70
FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL     71 - 140
DDIKDRSTLGEKLGGNVVVSLEGKPL                                                141 - 166
//

Text Mined References (46)

PMID Year Title
26996939 2016 TIRF microscopy analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover.
25814227 2015 Cofilin-2 phosphorylation and sequestration in myocardial aggregates: novel pathogenetic mechanisms for idiopathic dilated cardiomyopathy.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
24889065 2015 Progressive loss of myogenic differentiation in leiomyosarcoma has prognostic value.
24860983 2014 Muscle lim protein isoform negatively regulates striated muscle actin dynamics and differentiation.
24610938 2014 Novel cofilin-2 (CFL2) four base pair deletion causing nemaline myopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023293 2013 Malignant progressive tumor cell clone exhibits significant up-regulation of cofilin-2 and 27-kDa modified form of cofilin-1 compared to regressive clone.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...