Property Summary

NCBI Gene PubMed Count 26
PubMed Score 34.22
PubTator Score 25.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y279 Q6UXI4
Symbols CRIg
Z39IG

Gene

PDB

2ICE   2ICF   2ICC  

Gene RIF (13)

PMID Text
25687755 Data indicate that rotein kinase calpha (PKCalpha) plays a role in downregulating complement receptor Ig (CRIg coded by V-set and Ig domain-containing protein 4 VSIG4) expression.
25114177 complement receptor of the immunoglobulin superfamily-L-factor H protects glomerular mesangial cells from complement-mediated injury and proliferative lesions
24862966 Data indicate that massive V-set and Ig domain-containing 4 VSIG4(+) cell infiltration throughout the non-small-cell lung cancer samples.
24349325 we identified VSIG4 as a potential diagnostic marker of severe preeclampsia. The determination of this gene may improve the prognostic assessment of severe preeclampsia.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of V-set and immunoglobulin domain containing 4 (VSIG4) in peptide-treated PBMCs
23284715 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of V-set and immunoglobulin domain containing 4 (VSIG4) in peptide-treated PBMCs
21768202 we showed that a complement receptor of the Ig superfamily (CRIg, also known as Z39Ig), a receptor for complement fragments (C3b and iC3b), was expressed on a subset of intestinal macrophages in murine and human large intestine
20399148 These results suggest that T cells can opposite T cell hyporesponsiveness through dampening Z39Ig inhibitory signals from macrophages and thus maintain their anti-viral function in chronic hepatitis B.
19914289 hVSIG4 recombinant adenovirus-transfected DCs suppress T cell proliferation, cytokine production and activation marker expression with
17051150 CRIg is not only a phagocytic receptor, but also a potent inhibitor of the alternative pathway convertases
More...

AA Sequence

MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLR      1 - 70
DSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSV     71 - 140
SKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYF    141 - 210
CTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGK    211 - 280
SLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTS    281 - 350
QNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC                         351 - 399
//

Text Mined References (27)

PMID Year Title
25687755 2015 Protein kinase c? regulates the expression of complement receptor Ig in human monocyte-derived macrophages.
25114177 2014 A novel CRIg-targeted complement inhibitor protects cells from complement damage.
24862966 2014 VSIG4 expression on macrophages facilitates lung cancer development.
24349325 2013 Evaluation of current and new biomarkers in severe preeclampsia: a microarray approach reveals the VSIG4 gene as a potential blood biomarker.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21768202 2012 Phenotypic and functional profiles of CRIg (Z39Ig)-expressing macrophages in the large intestine.
20399148 2010 Down-regulation of Z39Ig on macrophages by IFN-gamma in patients with chronic HBV infection.
19914289 2010 Induction of T cells suppression by dendritic cells transfected with VSIG4 recombinant adenovirus.
19797726 2010 T-cell/histiocyte-rich large B-cell lymphoma shows transcriptional features suggestive of a tolerogenic host immune response.
18752851 2008 A role of macrophage complement receptor CRIg in immune clearance and inflammation.
More...