Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.87
PubTator Score 13.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.100 1.4e-02
Astrocytoma, Pilocytic -2.100 9.9e-07
atypical teratoid / rhabdoid tumor -1.200 1.0e-02
COPD 2.000 2.5e-03
ependymoma -1.800 1.8e-03
glioblastoma -1.400 4.5e-05
group 4 medulloblastoma -1.200 2.0e-02
lung cancer -1.900 7.6e-04
non-small cell lung cancer -1.600 7.4e-09
oligodendroglioma -1.600 4.5e-15
pediatric high grade glioma -1.600 1.6e-04
primitive neuroectodermal tumor -2.200 2.0e-03
psoriasis 1.400 8.7e-03

Gene RIF (10)

AA Sequence

MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQKS      1 - 70
RPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDV     71 - 140
RALGTEPHFFDRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTR    141 - 210
AISDYTQTLSKKPDIPTFEGLSFRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITD    211 - 280
PAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYR    281 - 350
PYNIKFYETVGQDFRWE                                                         351 - 367
//

Text Mined References (16)

PMID Year Title