Property Summary

NCBI Gene PubMed Count 16
Grant Count 12
R01 Count 9
Funding $547,063.41
PubMed Score 12.45
PubTator Score 13.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.500 0.000
posterior fossa group B ependymoma -2.200 0.000
psoriasis 1.400 0.009
glioblastoma -2.100 0.000
oligodendroglioma -1.600 0.000
sonic hedgehog group medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.200 0.010
primitive neuroectodermal tumor -2.200 0.002
non-small cell lung cancer -1.600 0.000
lung cancer -1.900 0.001
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -2.100 0.000
COPD 2.000 0.002

Gene RIF (10)

PMID Text
25842390 By interacting with tau at the intracellular level, the 3-O-sulphated heparan sulphates produced by HS3ST2 might act as molecular chaperones allowing the abnormal phosphorylation of tau
25198553 HS3ST2 and CCNA1 genes may play important roles in HPV-induced cervical cancer and patients with specific hypermethylated genes may have a greater risk of progressing to invasive cervical cancer.
24265783 HS3ST2 hypermethylation may be an independent prognostic indicator for overall survival in node-negative stage I-II NSCLC
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of heparan sulfate (glucosamine) 3-O-sulfotransferase 2 (HS3ST2) in peptide-treated PBMCs
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18757372 The 3OST-2 and -4 are specifically expressed in brain.
17482450 3-OST-2 and 3-OST-4 are the major neural gD-type 3-OSTs, and so are prime candidates for participating in HS-dependent neurobiologic events.
16336986 results raise the possibility of a role of 3-OST-2 in the spread of HSV-1 infection in the brain
12527896 These results showed that silencing of 3-OST-2 was present in a wide range of human cancersFrom the high incidence, silencing of the 3-OST-2 gene is expected to have high diagnostic, and potentially therapeutic, values.

AA Sequence

MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQKS      1 - 70
RPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDV     71 - 140
RALGTEPHFFDRNYGRGLDWYRSLMPRTLESQITLEKTPSYFVTQEAPRRIFNMSRDTKLIVVVRNPVTR    141 - 210
AISDYTQTLSKKPDIPTFEGLSFRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITD    211 - 280
PAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYR    281 - 350
PYNIKFYETVGQDFRWE                                                         351 - 367
//

Text Mined References (16)

PMID Year Title
25842390 2015 HS3ST2 expression is critical for the abnormal phosphorylation of tau in Alzheimer's disease-related tau pathology.
25198553 2014 Methylation in the promoters of HS3ST2 and CCNA1 genes is associated with cervical cancer in Uygur women in Xinjiang.
24265783 2013 Epigenetic inactivation of heparan sulfate (glucosamine) 3-O-sulfotransferase 2 in lung cancer and its role in tumorigenesis.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
18757372 2008 Tetrasulfated disaccharide unit in heparan sulfate: enzymatic formation and tissue distribution.
17482450 2007 The principal neuronal gD-type 3-O-sulfotransferases and their products in central and peripheral nervous system tissues.
16336986 2006 A role for heparan sulfate 3-O-sulfotransferase isoform 2 in herpes simplex virus type 1 entry and spread.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...