Property Summary

NCBI Gene PubMed Count 35
Grant Count 2
Funding $23,189.5
PubMed Score 26.57
PubTator Score 23.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.301 0.002
lung cancer 1.600 0.021
ovarian cancer 2.100 0.000

Synonym

Accession Q9Y277 Q9UIS0 VDAC-3
Symbols VDAC-3
HD-VDAC3

Gene

 Grant Application (2)

Gene RIF (15)

PMID Text
26947058 The works available on VDAC cysteines support the notion that VDAC1, VDAC2, and VDAC3 proteins are paralogs with a similar pore-function and slightly different, but important, ancillary biological functions. (Review)
26806159 VDAC3 is able to modulate its pore size and current by exploiting the mobility of the N-terminal and forming, upon external stimuli, disulfide bridges with cysteine residues located on the barrel and exposed to the inter-membrane space.
26407725 channel gating of VDAC3 might be controlled by redox sensing under physiological conditions
25341036 These data suggest that an interaction between Mcl-1 and VDAC promotes lung cancer cell migration by a mechanism that involves Ca(2+)-dependent reactive oxygen species production.
25171321 observed electrophysiological properties of hVDAC3 are surprisingly different from the other isoforms and are discussed in relation to the proposed physiological role of the protein in mammalian cells
23388454 a VDAC3-Mps1 module at the centrosome promotes ciliary disassembly during cell cycle entry.
23060438 VDAC 1, 2, and 3 recruit Parkin to defective mitochondria to promote mitochondrial autophagy.
22935710 VDAC3 is present at the mother centriole and modulates centriole assembly by recruiting Mps1 to centrosomes.
22190034 HIV-1 gp41 is identified to have a physical interaction with voltage-dependent anion channel 3 (VDAC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLT      1 - 70
FTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYG     71 - 140
WAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAW    141 - 210
TAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFE    211 - 280
LEA                                                                       281 - 283
//

Text Mined References (41)

PMID Year Title
26947058 2016 Role of cysteines in mammalian VDAC isoforms' function.
26806159 2016 A computational study of ion current modulation in hVDAC3 induced by disulfide bonds.
26407725 2015 VDAC3 gating is activated by suppression of disulfide-bond formation between the N-terminal region and the bottom of the pore.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25341036 2014 Mcl-1 promotes lung cancer cell migration by directly interacting with VDAC to increase mitochondrial Ca2+ uptake and reactive oxygen species generation.
25171321 2014 Recombinant human voltage dependent anion selective channel isoform 3 (hVDAC3) forms pores with a very small conductance.
23388454 2013 VDAC3 and Mps1 negatively regulate ciliogenesis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...