Property Summary

NCBI Gene PubMed Count 36
PubMed Score 30.67
PubTator Score 23.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.4e-05
Waldenstrons macroglobulinemia 765 1.5e-03
lung cancer 4740 2.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.600 2.1e-02
ovarian cancer 2.100 3.4e-05
Waldenstrons macroglobulinemia 1.301 1.5e-03

Protein-protein Interaction (6)

Gene RIF (16)

AA Sequence

MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLT      1 - 70
FTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYG     71 - 140
WAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAW    141 - 210
TAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFE    211 - 280
LEA                                                                       281 - 283
//

Text Mined References (42)

PMID Year Title