Property Summary

NCBI Gene PubMed Count 327
Grant Count 518
R01 Count 245
Funding $71,817,577.12
PubMed Score 1850.77
PubTator Score 896.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y275 E0ADT7 Q6FHD6 Q7Z5J2
Symbols DTL
BAFF
BLYS
CD257
TALL1
THANK
ZTNF4
TALL-1
TNLG7A
TNFSF20

Gene

PDB

1OQE   3V56   4V46   4ZCH   1OQD   1JH5   1KD7   1KXG   1OSG  

 GO Function (1)

Gene RIF (324)

PMID Text
27031098 Serum BAFF is unexpectedly found to be decreased in serum in response to the T cell independent immunogen Pneumovax 23.
26950089 Abnormal levels of BAFF/APRIL in pediatric acute lymphoblastic leukemia suggest that BAFF/APRIL are associated with the development and progression of this disease in children
26914861 expression levels of B cell-activating factor (BAFF) and B-cell maturation antigen were increased in multiple myeloma cells as compared with those in normal controls
26901523 The SNP BLYS -871C>T was associated with the frequency of IgG responders to PvAMA-1 and PvMSP-119.
26688003 Blood and salivary-gland BAFF-driven B-cell hyperactivity is associated to rituximab inefficacy in primary Sjogren's syndrome
26600308 The present study addresses how blood BAFF levels are associated with the clinical course of relapsing-remitting multiple sclerosis.
26590315 BAFF expression is directly induced by type I interferons via IRF1 and IRF2, whereas IRF4 and IRF8 are negative regulators of BAFF expression.
26461968 BAFF gene expression play an important role with transplant tolerance in patients receiving kidney transplants.
26424433 Serum BAFF was significantly higher in connective tissue disease-interstitial lung disease (CTD-ILD) patients compared to healthy subjects and chronic fibrosing interstitial pneumonia patients. BAFF was strongly expressed in CTD-ILD patient lungs.
26417991 role of TLR3/BAFF axis in IgA class-switch recombination of IgA nephropathy
More...

AA Sequence

MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVA      1 - 70
ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEE     71 - 140
TVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGH    141 - 210
LIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFG    211 - 280
ALKLL                                                                     281 - 285
//

Text Mined References (330)

PMID Year Title
27031098 2016 Reduced Number of Transitional and Naive B Cells in Addition to Decreased BAFF Levels in Response to the T Cell Independent Immunogen Pneumovax®23.
26950089 2016 Significance of BAFF/APRIL Expression and Their Receptors in Pediatric Patients With Acute Lymphoblastic Leukemia.
26914861 2016 Binding of B-cell maturation antigen to B-cell activating factor induces survival of multiple myeloma cells by activating Akt and JNK signaling pathways.
26901523 2016 Polymorphisms in B Cell Co-Stimulatory Genes Are Associated with IgG Antibody Responses against Blood-Stage Proteins of Plasmodium vivax.
26688003 2016 Blood and salivary-gland BAFF-driven B-cell hyperactivity is associated to rituximab inefficacy in primary Sjögren's syndrome.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26600308 2015 Changes in Blood B Cell-Activating Factor (BAFF) Levels in Multiple Sclerosis: A Sign of Treatment Outcome.
26590315 2016 The Expression of BAFF Is Controlled by IRF Transcription Factors.
26461968 2015 Longitudinal studies of a B cell-derived signature of tolerance in renal transplant recipients.
26424433 2015 Serum B cell-activating factor (BAFF) level in connective tissue disease associated interstitial lung disease.
More...