Property Summary

Ligand Count 1
NCBI Gene PubMed Count 358
PubMed Score 2109.42
PubTator Score 896.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
Multiple Sclerosis 1.500 1.2e-02
active Crohn's disease 1.347 1.2e-02
adult high grade glioma 1.400 8.8e-03
astrocytoma 1.100 1.2e-05
Astrocytoma, Pilocytic 1.900 3.8e-06
cystic fibrosis 1.700 1.1e-02
Duchenne muscular dystrophy 1.394 2.3e-07
gastric carcinoma 1.700 3.3e-02
glioblastoma multiforme 1.400 5.3e-12
group 4 medulloblastoma -1.400 5.7e-04
head and neck cancer and chronic obstruc... 1.300 9.2e-03
inflammatory breast cancer 1.700 6.4e-03
interstitial cystitis 2.300 2.0e-03
invasive ductal carcinoma 2.036 1.7e-05
juvenile dermatomyositis 2.298 5.5e-11
lung carcinoma -1.200 2.6e-13
medulloblastoma, large-cell -2.100 5.3e-06
non-small cell lung cancer -1.001 5.9e-06
osteosarcoma -1.771 2.3e-02
ovarian cancer -3.300 4.8e-07
pancreatic ductal adenocarcinoma liver m... 1.003 3.1e-02
primary Sjogren syndrome 1.900 1.2e-04
sarcoidosis 2.100 3.1e-02
subependymal giant cell astrocytoma 2.858 1.6e-02
tuberculosis 1.100 1.9e-03
ulcerative colitis 2.200 8.6e-06

Gene RIF (355)

AA Sequence

MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVA      1 - 70
ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEE     71 - 140
TVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGH    141 - 210
LIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFG    211 - 280
ALKLL                                                                     281 - 285
//

Text Mined References (361)

PMID Year Title