Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.83
PubTator Score 14.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
gastric cancer 1.100 0.005
pancreatic cancer 1.500 0.001
Multiple myeloma 2.366 0.014
malignant mesothelioma -1.700 0.000
psoriasis -1.200 0.005
osteosarcoma -2.092 0.003
ependymoma -1.300 0.001
cystic fibrosis 1.400 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
group 3 medulloblastoma -1.500 0.020
medulloblastoma, large-cell -2.500 0.000
fascioscapulohumeral muscular dystrophy 1.082 0.000
adrenocortical carcinoma -1.214 0.022
pancreatic ductal adenocarcinoma liver m... -2.123 0.002
tuberculosis and treatment for 6 months -1.600 0.001
non-small cell lung cancer -1.168 0.000
intraductal papillary-mucinous carcinoma... -2.000 0.036
lung cancer -2.700 0.000
interstitial cystitis 1.100 0.002
pilocytic astrocytoma 1.300 0.002
pancreatic carcinoma 1.500 0.001
Endometriosis -1.598 0.032
lung carcinoma -1.400 0.000
Pick disease -1.100 0.000
Breast cancer -2.000 0.000
invasive ductal carcinoma -1.500 0.002
ovarian cancer -2.800 0.000

Synonym

Accession Q9Y274 B2RCH2 B3KMI1 D3DN39 F8W6U0
Symbols SIAT10
ST3GALVI

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
25061176 The sialyltransferase ST3GAL6 influences homing and survival in multiple myeloma.
21147760 the occurrence of CD75s- and iso-CD75s-gangliosides in tumor tissues is largely independent of the transcriptional expression of ST6GAL1 and ST3GAL6
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19781661 Expression of ST3Gal IV in several gastrointestinal cell lines is correlated with the expression of sialyl Lewis x at the cell surface.
18485915 Epigenetic changes in a group of glycosyltransferases including B4GALNT2 and ST3GAL6 represent a malignant phenotype of gastric cancer caused by silencing of the activity of these enzymes

AA Sequence

MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFR      1 - 70
KIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYD     71 - 140
VIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNG    141 - 210
FWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFK    211 - 280
YNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD                       281 - 331
//

Text Mined References (22)

PMID Year Title
25061176 2014 The sialyltransferase ST3GAL6 influences homing and survival in multiple myeloma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22700726 2012 Coordinated roles of ST3Gal-VI and ST3Gal-IV sialyltransferases in the synthesis of selectin ligands.
22649524 2012 A fine-mapping study of 7 top scoring genes from a GWAS for major depressive disorder.
22025563 2011 Selectin ligand sialyl-Lewis x antigen drives metastasis of hormone-dependent breast cancers.
21147760 2011 Differences in CD75s- and iso-CD75s-ganglioside content and altered mRNA expression of sialyltransferases ST6GAL1 and ST3GAL6 in human hepatocellular carcinomas and nontumoral liver tissues.
20826224 2010 A functional analysis of N-glycosylation-related genes on sialylation of recombinant erythropoietin in six commonly used mammalian cell lines.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
19781661 2010 Differential expression of alpha-2,3-sialyltransferases and alpha-1,3/4-fucosyltransferases regulates the levels of sialyl Lewis a and sialyl Lewis x in gastrointestinal carcinoma cells.
More...