Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.43
PubTator Score 14.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.214 2.2e-02
Astrocytoma, Pilocytic 1.300 2.1e-03
atypical teratoid / rhabdoid tumor -2.100 9.1e-07
Breast cancer -1.500 3.2e-06
cystic fibrosis 1.161 8.8e-05
Endometriosis -1.448 3.1e-02
ependymoma -1.100 1.6e-03
fascioscapulohumeral muscular dystrophy 1.082 4.6e-04
gastric cancer 1.100 4.7e-03
group 3 medulloblastoma -1.500 2.0e-02
interstitial cystitis 1.100 2.0e-03
intraductal papillary-mucinous carcinoma... -2.000 3.6e-02
invasive ductal carcinoma -1.100 2.9e-03
lung cancer -2.700 3.3e-05
lung carcinoma -1.400 4.2e-13
malignant mesothelioma -1.700 1.7e-06
medulloblastoma, large-cell -2.100 3.8e-04
Multiple myeloma 1.938 1.4e-02
non-small cell lung cancer -1.168 5.5e-15
osteosarcoma -1.595 2.3e-02
ovarian cancer 1.200 9.8e-03
pancreatic cancer 1.100 5.1e-03
pancreatic carcinoma 1.100 5.1e-03
pancreatic ductal adenocarcinoma liver m... -1.026 3.5e-02
Pick disease -1.100 1.5e-05
psoriasis -1.100 1.6e-03
tuberculosis -1.400 5.2e-04

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFR      1 - 70
KIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYD     71 - 140
VIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNG    141 - 210
FWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFK    211 - 280
YNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD                       281 - 331
//

Text Mined References (22)

PMID Year Title