Property Summary

NCBI Gene PubMed Count 31
Grant Count 55
R01 Count 33
Funding $5,656,946.48
PubMed Score 104.93
PubTator Score 39.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26358293 Data indicate that protein kinase A (PKA) phosphorylates only serine-253 amino acid on activator of G-protein signaling 1 protein Dexras1 (RASD1).
26083271 Studies indicate potential roles for Rasd1 small G protein and leptin in TRPC4 cation channel activation.
24761910 Loss of RASD1 is associated with prostate cancer.
21915321 Study showed that Rasd1 and NonO interact at the CRE-site of specific target genes.
21247419 Rasd1 modulates endogenous renin gene expression by interacting with Ear2.
19549772 Epigenetic inactivation of genes, including RASD1, plays a key role in the development of dexamethasone resistance in multiple myeloma.
18922798 Dexras1 functions as a suppressor of FE65-APP-mediated transcription, and FE65 tyrosine 547 phosphorylation enhances FE65-APP-mediated transcription, at least in part, by modulating the interaction between FE65 and Dexras1
17985234 dex-ras1 mRNA is not induced by glucocorticoid stimulation in HEK293 cells
17167088 Dexras1 plays a critical role in shaping the photic phase response curve (PRC) and the signaling events through which it regulates clock entrainment in transgenic mice.
16489124 does not alter the membrane translocation of protein kinase C delta.
More...

AA Sequence

MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGE      1 - 70
VYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPL     71 - 140
VICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS    141 - 210
VQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVI    211 - 280
S//

Text Mined References (33)

PMID Year Title
26358293 2015 PKA-mediated phosphorylation of Dexras1 suppresses iron trafficking by inhibiting S-nitrosylation.
26083271 2015 The Roles of Rasd1 small G proteins and leptin in the activation of TRPC4 transient receptor potential channels.
25416956 2014 A proteome-scale map of the human interactome network.
24761910 2014 Up-regulating of RASD1 and apoptosis of DU-145 human prostate cancer cells induced by formononetin in vitro.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
21915321 2011 Rasd1 modulates the coactivator function of NonO in the cyclic AMP pathway.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21247419 2011 Rasd1 interacts with Ear2 (Nr2f6) to regulate renin transcription.
19549772 2009 Genomic screening for genes silenced by DNA methylation revealed an association between RASD1 inactivation and dexamethasone resistance in multiple myeloma.
18922798 2008 Dexras1 interacts with FE65 to regulate FE65-amyloid precursor protein-dependent transcription.
More...