Property Summary

Ligand Count 92
NCBI Gene PubMed Count 87
PubMed Score 378.28
PubTator Score 277.50

Knowledge Summary

Patent (4,888)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.100 4.1e-04
Astrocytoma, Pilocytic 1.700 3.7e-07
facioscapulohumeral dystrophy 1.800 4.0e-02
glioblastoma 1.100 8.2e-04
interstitial cystitis 1.700 6.7e-04
lung carcinoma -1.700 4.4e-15
non-small cell lung cancer -1.155 2.0e-13
osteosarcoma -2.039 1.7e-08
ovarian cancer -1.700 5.6e-06
primary Sjogren syndrome 1.200 8.2e-03
tuberculosis 1.400 7.8e-04
ulcerative colitis 1.400 5.9e-04
urothelial carcinoma -1.600 5.0e-04

Gene RIF (78)

AA Sequence

MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADL      1 - 70
LCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKA     71 - 140
RFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYT    141 - 210
MIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVIT    211 - 280
LSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV                 281 - 337
//

Text Mined References (87)

PMID Year Title