Property Summary

NCBI Gene PubMed Count 82
Grant Count 71
R01 Count 39
Funding $6,913,854.36
PubMed Score 368.18
PubTator Score 277.50

Knowledge Summary

Patent (4,888)

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.700 0.010
osteosarcoma -2.148 0.000
glioblastoma 1.100 0.001
tuberculosis 1.400 0.001
non-small cell lung cancer -1.533 0.000
interstitial cystitis 1.800 0.001
adult high grade glioma 1.100 0.000
pilocytic astrocytoma 1.700 0.000
primary Sjogren syndrome 1.200 0.008
lung carcinoma -1.700 0.000
ulcerative colitis 1.400 0.001
ovarian cancer -1.700 0.000
facioscapulohumeral dystrophy 1.800 0.040

Synonym

Accession Q9Y271 B2R954 D3DTE4 Q5JS94 Q8IV19 CysLTR1
Symbols CYSLT1
CYSLTR
CYSLT1R
HMTMF81

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
More...

Gene RIF (73)

PMID Text
25918735 in allergen-sensitized individuals, exposure to allergen can enhance T cell expression of CysLT1. This, in turn, would induce enhanced CD4+ T cell responsiveness to cysLTs, T cell activation, and Th2 polarization.
25760841 CysLTR-1 and CysLTR-2 are highly expressed in the adenoid tissues from children with AH, suggesting that leukotrienes are involved in the pathogenesis of AH.
24350867 The 5-LOX/LTC4 /CysLT1 signaling pathway regulates EGF-induced cell migration by increasing Tiam1 expression.
24162774 HIV-1 gp120 downregulates the expression of cysteinyl leukotriene receptor 1 (CYSLTR1) in human B cells
23977066 Cysteinyl leukotrienes signaling downstream of CysLT1R in mast cells is differentially regulated by two distinct PKCalpha and PKC epsilon.
23181793 Genetic variant may play a role in NSAID induced acute urticaria.
23124618 A significant relationship was found between the expression of CysLT1 receptor and GR-beta in nasal polyps (R = .525, P = .04), whereas there was no significant relationship between the expression of CysLT1 receptor and GR-alpha in nasal polyps.
23085741 CysLT(1) receptors in endothelial cells translocate to the nucleus in a ligand-independent manner after ischemic insult in vitro, and it is involved in the ischemic injury.
22871757 Bronchial mucosal CysLT1 receptor-positive inflammatory cells are present in the bronchial mucosa in COPD in greatest number in those experiencing a severe exacerbation.
22634478 increased expression in tonsillar tissues of Chinese children with sleep-disordered breathing
More...

AA Sequence

MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADL      1 - 70
LCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKA     71 - 140
RFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYT    141 - 210
MIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVIT    211 - 280
LSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV                 281 - 337
//

Text Mined References (82)

PMID Year Title
25918735 2015 Enhanced cysteinyl-leukotriene type 1 receptor expression in T cells from house dust mite-allergic individuals following stimulation with Der p.
25760841 2015 [Expression of CysLTR-1 and CysLTR-2 in adenoid tissues from children with adenoid hypertrophy].
24350867 2014 5-Lipoxygenase and cysteinyl leukotriene receptor 1 regulate epidermal growth factor-induced cell migration through Tiam1 upregulation and Rac1 activation.
23977066 2013 Differential regulation of cysteinyl leukotriene receptor signaling by protein kinase C in human mast cells.
23859232 2013 A review on leukotrienes and their receptors with reference to asthma.
23822826 2013 Antileukotriene agents for the treatment of lung disease.
23181793 2012 Genetic variants of the arachidonic acid pathway in non-steroidal anti-inflammatory drug-induced acute urticaria.
23124618 2013 Expression of the cysteinyl leukotriene 1 receptor and glucocorticoid receptor-? in nasal polyps.
23085741 2012 Nuclear translocation of cysteinyl leukotriene receptor 1 is involved in oxygen-glucose deprivation-induced damage to endothelial cells.
22871757 2012 Cysteinyl leukotriene 1 receptor expression associated with bronchial inflammation in severe exacerbations of COPD.
More...