Property Summary

NCBI Gene PubMed Count 35
PubMed Score 54.63
PubTator Score 32.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lissencephaly 69 5.311 2.7

Expression

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTR      1 - 70
REKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSP     71 - 140
GKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVG    141 - 210
LKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLD    211 - 280
SETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN                       281 - 331
//

Text Mined References (44)

PMID Year Title