Property Summary

NCBI Gene PubMed Count 33
Grant Count 24
R01 Count 15
Funding $1,865,663
PubMed Score 52.29
PubTator Score 32.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Lissencephaly 61 5.332 2.7

Expression

Gene RIF (15)

PMID Text
27074040 NudC is co-localized with Aurora B at the midbody and co-immunoprecipitated with Aurora B in mitosis. results suggest that that dynamic phosphorylation of NudC by Aurora B regulates cytokinesis.
24069238 NudC acetylation/deacetylation regulates mitotic progression and NudC deacetylation, likely through HDAC3, is critical for spindle function and chromosome congression.
23364796 HIV-1 Tat upregulates the expression of nudC nuclear distribution protein (NUDC) in Jurkat cells
22190034 HIV-1 Tat upregulates the expression of nudC nuclear distribution protein (NUDC) in Jurkat cells
21473139 Human nuclear distribution C is found to be closely associated with cell malignant hyperplasia in nasopharyngeal carcinoma.
20675372 NudC may be involved in the regulation of LIS1 stability by its chaperone function.
20529857 separate binding sites on the Mpl receptor for TPO and hNUDC identified
19560457 Mpl plays an important and specific role in mediating hNUDC-induced megakaryocyte proliferation and differentiation.
18288130 hNUDC induced a sustained activation of the extracellular signal-regulated protein kinases-1 and -2 (ERK1/2) as well as p38 mitogen-activated kinase (p38 MAPK) pathways
17658515 hNUDC induced significant changes in cellular morphology in NIH 3T3 cells stably transfected with pMpl-EGFP. Interestingly, these morphological changes were characteristic of cells undergoing megakaryocyte differentiation.
More...

AA Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTR      1 - 70
REKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSP     71 - 140
GKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVG    141 - 210
LKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLD    211 - 280
SETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN                       281 - 331
//

Text Mined References (42)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27074040 2016 Dynamic Phosphorylation of NudC by Aurora B in Cytokinesis.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24069238 2013 NudC deacetylation regulates mitotic progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21473139 2011 [Expression and clinical significance of human nuclear distribution C in nasopharyngeal carcinoma].
More...