Tbio | RuvB-like 1 |
May be able to bind plasminogen at cell surface and enhance plasminogen activation.
This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 2.27862794993429E-19 |
posterior fossa group B ependymoma | 1530 | 3.24894353341874E-17 |
glioblastoma | 5572 | 8.52088272605016E-11 |
pediatric high grade glioma | 2712 | 8.0433599451163E-9 |
atypical teratoid / rhabdoid tumor | 4369 | 1.40721346202306E-8 |
malignant mesothelioma | 3163 | 1.53520242837965E-7 |
group 3 medulloblastoma | 2254 | 5.16446180667224E-7 |
medulloblastoma, large-cell | 6234 | 2.09064029826001E-6 |
primitive neuroectodermal tumor | 3031 | 1.74882027879584E-5 |
lung cancer | 4473 | 1.7575552189981E-5 |
invasive ductal carcinoma | 2950 | 1.39603575655556E-4 |
colon cancer | 1475 | 5.6805227263564E-4 |
ovarian cancer | 8492 | 0.00482965625243215 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Intermittent explosive disorder | 4 | 3.61 | 1.8 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 1.700 | 0.000 |
posterior fossa group B ependymoma | 2.500 | 0.000 |
glioblastoma | 1.400 | 0.000 |
group 3 medulloblastoma | 1.800 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.700 | 0.000 |
medulloblastoma, large-cell | 2.500 | 0.000 |
primitive neuroectodermal tumor | 1.700 | 0.000 |
non-small cell lung cancer | 1.389 | 0.000 |
lung cancer | 2.400 | 0.000 |
colon cancer | 1.100 | 0.001 |
pediatric high grade glioma | 1.300 | 0.000 |
invasive ductal carcinoma | 1.300 | 0.000 |
ovarian cancer | 1.200 | 0.005 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
Fruitfly | OMA EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26863765 | by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring |
26711270 | The interaction of ECD with RUVBL1, and its CK2-mediated phosphorylation, independent of its interaction with PIH1D1, are important for its cell cycle regulatory function. |
26303906 | RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils. |
26201077 | data thus demonstrate that RUVBL1 is essential for efficient mitosis and proliferation. |
25857266 | Results highlight an important role and mechanism for Pontin, a new mutp53 partner, in promoting mutp53 GOF in tumorigenesis. |
25751257 | Study showed that pontin is up-regulated in renal cell carcinoma (RCC) and high cytoplasmic pontin expression was associated with poor survival of RCC patients. |
25428364 | The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex. |
25336637 | Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction. |
24990942 | these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination. |
24728183 | Results showed RUVBL1 promoting concentration of G-actin subunits and polymerization of actin filaments via its direct binding to F-actin in cell protrusions and results in increased invasive properties of pancreatic ductal adenocarcinoma cells. |
More... |
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG 1 - 70 PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP 71 - 140 CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA 141 - 210 TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN 211 - 280 KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI 281 - 350 PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN 351 - 420 GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK 421 - 456 //
PMID | Year | Title |
---|---|---|
26863765 | 2015 | [DYNAMICS AND MECHANISMS OF INTERACTION OF HETERO-HEXAMERIC TIP49a/b COMPLEXES WITH DS-DNA]. |
26711270 | 2015 | A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. |
26303906 | 2015 | RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils. |
26201077 | 2015 | Chromosome Missegregation Associated with RUVBL1 Deficiency. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25857266 | 2015 | Pontin, a new mutant p53-binding protein, promotes gain-of-function of mutant p53. |
25755297 | 2015 | System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability. |
25751257 | 2015 | Cytoplasmic expression of pontin in renal cell carcinoma correlates with tumor invasion, metastasis and patients' survival. |
25468996 | 2014 | E-cadherin interactome complexity and robustness resolved by quantitative proteomics. |
25467444 | 2014 | Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1. |
More... |