Property Summary

NCBI Gene PubMed Count 87
PubMed Score 71.91
PubTator Score 78.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.27862794993429E-19
posterior fossa group B ependymoma 1530 3.24894353341874E-17
glioblastoma 5572 8.52088272605016E-11
pediatric high grade glioma 2712 8.0433599451163E-9
atypical teratoid / rhabdoid tumor 4369 1.40721346202306E-8
malignant mesothelioma 3163 1.53520242837965E-7
group 3 medulloblastoma 2254 5.16446180667224E-7
medulloblastoma, large-cell 6234 2.09064029826001E-6
primitive neuroectodermal tumor 3031 1.74882027879584E-5
lung cancer 4473 1.7575552189981E-5
invasive ductal carcinoma 2950 1.39603575655556E-4
colon cancer 1475 5.6805227263564E-4
ovarian cancer 8492 0.00482965625243215
Disease Target Count Z-score Confidence
Intermittent explosive disorder 4 3.61 1.8

Expression

  Differential Expression (13)

Synonym

Accession Q9Y265 B2R5S0 P82276 Q1KMR0 Q53HK5 Q53HL7 Q53Y27 Q9BSX9
Symbols RVB1
TIH1
ECP54
TIP49
ECP-54
INO80H
NMP238
PONTIN
TIP49A
NMP 238
Pontin52

Gene

PDB

2C9O   2XSZ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 IMPC Term (1)

Gene RIF (44)

PMID Text
26863765 by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring
26711270 The interaction of ECD with RUVBL1, and its CK2-mediated phosphorylation, independent of its interaction with PIH1D1, are important for its cell cycle regulatory function.
26303906 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26201077 data thus demonstrate that RUVBL1 is essential for efficient mitosis and proliferation.
25857266 Results highlight an important role and mechanism for Pontin, a new mutp53 partner, in promoting mutp53 GOF in tumorigenesis.
25751257 Study showed that pontin is up-regulated in renal cell carcinoma (RCC) and high cytoplasmic pontin expression was associated with poor survival of RCC patients.
25428364 The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex.
25336637 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
24990942 these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination.
24728183 Results showed RUVBL1 promoting concentration of G-actin subunits and polymerization of actin filaments via its direct binding to F-actin in cell protrusions and results in increased invasive properties of pancreatic ductal adenocarcinoma cells.
More...

AA Sequence

MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG      1 - 70
PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP     71 - 140
CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA    141 - 210
TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN    211 - 280
KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI    281 - 350
PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN    351 - 420
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK                                      421 - 456
//

Text Mined References (98)

PMID Year Title
26863765 2015 [DYNAMICS AND MECHANISMS OF INTERACTION OF HETERO-HEXAMERIC TIP49a/b COMPLEXES WITH DS-DNA].
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26303906 2015 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26201077 2015 Chromosome Missegregation Associated with RUVBL1 Deficiency.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25857266 2015 Pontin, a new mutant p53-binding protein, promotes gain-of-function of mutant p53.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25751257 2015 Cytoplasmic expression of pontin in renal cell carcinoma correlates with tumor invasion, metastasis and patients' survival.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
More...