| Tbio | RuvB-like 1 |
May be able to bind plasminogen at cell surface and enhance plasminogen activation.
This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 2.27862794993429E-19 |
| posterior fossa group B ependymoma | 1530 | 3.24894353341874E-17 |
| glioblastoma | 5572 | 8.52088272605016E-11 |
| pediatric high grade glioma | 2712 | 8.0433599451163E-9 |
| atypical teratoid / rhabdoid tumor | 4369 | 1.40721346202306E-8 |
| malignant mesothelioma | 3163 | 1.53520242837965E-7 |
| group 3 medulloblastoma | 2254 | 5.16446180667224E-7 |
| medulloblastoma, large-cell | 6234 | 2.09064029826001E-6 |
| primitive neuroectodermal tumor | 3031 | 1.74882027879584E-5 |
| lung cancer | 4473 | 1.7575552189981E-5 |
| invasive ductal carcinoma | 2950 | 1.39603575655556E-4 |
| colon cancer | 1475 | 5.6805227263564E-4 |
| ovarian cancer | 8492 | 0.00482965625243215 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Intermittent explosive disorder | 4 | 3.61 | 1.8 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | 1.700 | 0.000 |
| posterior fossa group B ependymoma | 2.500 | 0.000 |
| glioblastoma | 1.400 | 0.000 |
| group 3 medulloblastoma | 1.800 | 0.000 |
| atypical teratoid / rhabdoid tumor | 1.700 | 0.000 |
| medulloblastoma, large-cell | 2.500 | 0.000 |
| primitive neuroectodermal tumor | 1.700 | 0.000 |
| non-small cell lung cancer | 1.389 | 0.000 |
| lung cancer | 2.400 | 0.000 |
| colon cancer | 1.100 | 0.001 |
| pediatric high grade glioma | 1.300 | 0.000 |
| invasive ductal carcinoma | 1.300 | 0.000 |
| ovarian cancer | 1.200 | 0.005 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Macaque | OMA EggNOG Inparanoid |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Opossum | OMA EggNOG Inparanoid |
| Platypus | OMA EggNOG |
| Chicken | OMA EggNOG Inparanoid |
| Anole lizard | OMA EggNOG Inparanoid |
| Xenopus | OMA EggNOG Inparanoid |
| C. elegans | OMA EggNOG Inparanoid |
| Fruitfly | OMA EggNOG Inparanoid |
| S.cerevisiae | OMA EggNOG Inparanoid |
| PMID | Text |
|---|---|
| 26863765 | by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring |
| 26711270 | The interaction of ECD with RUVBL1, and its CK2-mediated phosphorylation, independent of its interaction with PIH1D1, are important for its cell cycle regulatory function. |
| 26303906 | RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils. |
| 26201077 | data thus demonstrate that RUVBL1 is essential for efficient mitosis and proliferation. |
| 25857266 | Results highlight an important role and mechanism for Pontin, a new mutp53 partner, in promoting mutp53 GOF in tumorigenesis. |
| 25751257 | Study showed that pontin is up-regulated in renal cell carcinoma (RCC) and high cytoplasmic pontin expression was associated with poor survival of RCC patients. |
| 25428364 | The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex. |
| 25336637 | Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction. |
| 24990942 | these findings suggest that YY1-RuvBL1-RuvBL2 complexes could contribute to functions beyond transcription, and we show that YY1 and the ATPase activity of RuvBL2 are required for RAD51 foci formation during homologous recombination. |
| 24728183 | Results showed RUVBL1 promoting concentration of G-actin subunits and polymerization of actin filaments via its direct binding to F-actin in cell protrusions and results in increased invasive properties of pancreatic ductal adenocarcinoma cells. |
| More... |
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG 1 - 70 PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP 71 - 140 CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA 141 - 210 TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN 211 - 280 KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI 281 - 350 PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN 351 - 420 GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK 421 - 456 //
| PMID | Year | Title |
|---|---|---|
| 26863765 | 2015 | [DYNAMICS AND MECHANISMS OF INTERACTION OF HETERO-HEXAMERIC TIP49a/b COMPLEXES WITH DS-DNA]. |
| 26711270 | 2015 | A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression. |
| 26303906 | 2015 | RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils. |
| 26201077 | 2015 | Chromosome Missegregation Associated with RUVBL1 Deficiency. |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 25857266 | 2015 | Pontin, a new mutant p53-binding protein, promotes gain-of-function of mutant p53. |
| 25755297 | 2015 | System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability. |
| 25751257 | 2015 | Cytoplasmic expression of pontin in renal cell carcinoma correlates with tumor invasion, metastasis and patients' survival. |
| 25468996 | 2014 | E-cadherin interactome complexity and robustness resolved by quantitative proteomics. |
| 25467444 | 2014 | Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1. |
| More... |
