Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.07
PubTator Score 22.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.000 0.001
psoriasis -1.200 0.000

Synonym

Accession Q9Y264 B4E3J9 Q5TFF4 Q9H4Z4 ANG-4
Symbols ANG3
ANG4

Gene

PANTHER Protein Class (1)

Gene RIF (14)

PMID Text
25977256 Ang-4 also promoted survival of LECs. Thus, blocking Ang-4 may prune the draining lymphatic vasculature and decrease interstitial fluid pressure (IFP) by reducing vascular permeability.
24760148 acute-phase protein A1AT is a physiological regulator of angptl4, another acute-phase protein.
22267746 Angptl4 is a glucocorticoid-responsive mediator of fasting-induced intracellular lipolysis and stimulates cAMP signaling in adipocytes
21603628 In tumor cells, only Ang-4 expression has prognostic impact in NSCLC. In NSCLC tumor stroma, Ang-4 and Ang-2 are independently associated with survival.
20823154 Results establish the novel effects of Ang-4 on tumor angiogenesis and GBM progression and suggest that this pro-GBM effect of Ang-4 is mediated by promoting tumor angiogenesis and activating Erk1/2 kinase in GBM cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596041 Linkage to 20p13 including the ANGPT4 gene in families with mixed Alzheimer disease and vascular dementia is reported.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQR      1 - 70
ESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLN     71 - 140
QTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQ    141 - 210
EELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAF    211 - 280
IMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYK    281 - 350
QGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQ    351 - 420
SSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYS    421 - 490
LRASRMMIRPLDI                                                             491 - 503
//

Text Mined References (28)

PMID Year Title
25977256 2015 Angiopoietin-4 increases permeability of blood vessels and promotes lymphatic dilation.
24760148 2014 Acute-phase protein ?1-antitrypsin--a novel regulator of angiopoietin-like protein 4 transcription and secretion.
22267746 2012 Angiopoietin-like 4 (Angptl4) protein is a physiological mediator of intracellular lipolysis in murine adipocytes.
21603628 2011 Prognostic impacts of angiopoietins in NSCLC tumor cells and stroma: VEGF-A impact is strongly associated with Ang-2.
20823154 2010 Angiopoietin-4 promotes glioblastoma progression by enhancing tumor cell viability and angiogenesis.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596041 2010 Linkage to 20p13 including the ANGPT4 gene in families with mixed Alzheimer's disease and vascular dementia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19234476 2009 Control of vascular morphogenesis and homeostasis through the angiopoietin-Tie system.
More...