Property Summary

NCBI Gene PubMed Count 22
PubMed Score 81.46
PubTator Score 91.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Inflammation 109
Disease Target Count P-value
ovarian cancer 8492 1.5121595526586E-4
group 3 medulloblastoma 2254 9.73844929926384E-4
osteosarcoma 7933 0.00102650377320352
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.261 0.001
group 3 medulloblastoma 1.300 0.001
ovarian cancer 1.400 0.000

Synonym

Accession Q9Y263 Q53EU5 Q5VY33 Q9NUL8 Q9NVE9 Q9UF53 Q9Y5L1 PLA2P
Symbols DOA1
PLAP
PLA2P

Gene

PANTHER Protein Class (1)

PDB

2K8B   2K8C   3EBB   2K89   2K8A  

  Ortholog (14)

Gene RIF (7)

PMID Text
25448737 This review provides evidence that 1,25-dihydroxy vitamin D3 stimulates PLA2 via PLAA and CaMKII, a process initiated by Pdia3/PLAA interaction, which further triggers CaMKII-dependent PLA2 activation. [review]
20574843 Observational study of gene-disease association. (HuGE Navigator)
20185149 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19423704 Structural basis for ubiquitin recognition by a novel domain from the human phospholipase A2-activating protein
18291623 identified one stimulatory element, with Sp1 binding sites, and one inhibitory element, in exon 1 of the plaa gene
14499668 PLAP inhibits sPLA2-triggered release of fatty acids from erythrocyte membranes
11937510 Function assignment to conserved residues in mammalian alkaline phosphatases.

AA Sequence

MTSGATRYRLSCSLRGHELDVRGLVCCAYPPGAFVSVSRDRTTRLWAPDSPNRSFTEMHCMSGHSNFVSC      1 - 70
VCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKNTVCSLSSGKFGTLLSGSWDTTAKVWLN     71 - 140
DKCMMTLQGHTAAVWAVKILPEQGLMLTGSADKTVKLWKAGRCERTFSGHEDCVRGLAILSETEFLSCAN    141 - 210
DASIRRWQITGECLEVYYGHTNYIYSISVFPNCRDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVL    211 - 280
DNGDIVVGASDGIIRVFTESEDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTRE    281 - 350
GQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPY    351 - 420
NTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPT    421 - 490
ADPFTGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNG    491 - 560
TAPEEKKLTEDDLILLEKILSLICNSSSEKPTVQQLQILWKAINCPEDIVFPALDILRLSIKHPSVNENF    561 - 630
CNEKEGAQFSSHLINLLNPKGKPANQLLALRTFCNCFVGQAGQKLMMSQRESLMSHAIELKSGSNKNIHI    631 - 700
ALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDS    701 - 770
QIKKYSSVSEPAKVSECCRFILNLL                                                 771 - 795
//

Text Mined References (27)

PMID Year Title
25448737 2015 Membrane-mediated actions of 1,25-dihydroxy vitamin D3: a review of the roles of phospholipase A2 activating protein and Ca(2+)/calmodulin-dependent protein kinase II.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20185149 2010 Gene variants associated with schizophrenia in a Norwegian genome-wide study are replicated in a large European cohort.
19887378 2010 Structure and function of the PLAA/Ufd3-p97/Cdc48 complex.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19423704 2009 Structural basis for ubiquitin recognition by a novel domain from human phospholipase A2-activating protein.
18775313 2008 UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.
18291623 2008 Alteration in the activation state of new inflammation-associated targets by phospholipase A2-activating protein (PLAA).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17076679 Specific isolation of placenta-derived exosomes from the circulation of pregnant women and their immunoregulatory consequences.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14499668 2003 Bimodal regulatory effect of melittin and phospholipase A2-activating protein on human type II secretory phospholipase A2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11937510 2002 Function assignment to conserved residues in mammalian alkaline phosphatases.
11689694 2001 Identification of components of the murine histone deacetylase 6 complex: link between acetylation and ubiquitination signaling pathways.
10644453 1999 Chromosomal localization of phospholipase A2 activating protein, an Ets2 target gene, to 9p21.
10571045 1999 Cloning of the human phospholipase A2 activating protein (hPLAP) gene on the chromosome 9p21 melanoma deleted region.
9931468 1999 Molecular characterization of cDNA for phospholipase A2-activating protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2052621 1991 Cloning of a phospholipase A2-activating protein.