Property Summary

Ligand Count 2
NCBI Gene PubMed Count 25
PubMed Score 83.76
PubTator Score 91.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Inflammation 120 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.5e-04
group 3 medulloblastoma 4104 9.7e-04
osteosarcoma 7950 1.0e-03
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.4
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 9.7e-04
osteosarcoma 1.261 1.0e-03
ovarian cancer 1.400 1.5e-04

Gene RIF (10)

AA Sequence

MTSGATRYRLSCSLRGHELDVRGLVCCAYPPGAFVSVSRDRTTRLWAPDSPNRSFTEMHCMSGHSNFVSC      1 - 70
VCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKNTVCSLSSGKFGTLLSGSWDTTAKVWLN     71 - 140
DKCMMTLQGHTAAVWAVKILPEQGLMLTGSADKTVKLWKAGRCERTFSGHEDCVRGLAILSETEFLSCAN    141 - 210
DASIRRWQITGECLEVYYGHTNYIYSISVFPNCRDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVL    211 - 280
DNGDIVVGASDGIIRVFTESEDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTRE    281 - 350
GQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPY    351 - 420
NTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPT    421 - 490
ADPFTGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNG    491 - 560
TAPEEKKLTEDDLILLEKILSLICNSSSEKPTVQQLQILWKAINCPEDIVFPALDILRLSIKHPSVNENF    561 - 630
CNEKEGAQFSSHLINLLNPKGKPANQLLALRTFCNCFVGQAGQKLMMSQRESLMSHAIELKSGSNKNIHI    631 - 700
ALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDS    701 - 770
QIKKYSSVSEPAKVSECCRFILNLL                                                 771 - 795
//

Text Mined References (30)

PMID Year Title