Property Summary

NCBI Gene PubMed Count 22
Grant Count 63
R01 Count 41
Funding $8,588,240.74
PubMed Score 81.46
PubTator Score 91.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.261 0.001
group 3 medulloblastoma 1.300 0.001
ovarian cancer 1.400 0.000

Synonym

Accession Q9Y263 Q53EU5 Q5VY33 Q9NUL8 Q9NVE9 Q9UF53 Q9Y5L1 PLA2P
Symbols DOA1
PLAP
PLA2P

Gene

PANTHER Protein Class (1)

PDB

2K8B   2K8C   3EBB   2K89   2K8A  

Gene RIF (7)

PMID Text
25448737 This review provides evidence that 1,25-dihydroxy vitamin D3 stimulates PLA2 via PLAA and CaMKII, a process initiated by Pdia3/PLAA interaction, which further triggers CaMKII-dependent PLA2 activation. [review]
20574843 Observational study of gene-disease association. (HuGE Navigator)
20185149 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19423704 Structural basis for ubiquitin recognition by a novel domain from the human phospholipase A2-activating protein
18291623 identified one stimulatory element, with Sp1 binding sites, and one inhibitory element, in exon 1 of the plaa gene
14499668 PLAP inhibits sPLA2-triggered release of fatty acids from erythrocyte membranes
11937510 Function assignment to conserved residues in mammalian alkaline phosphatases.

AA Sequence

MTSGATRYRLSCSLRGHELDVRGLVCCAYPPGAFVSVSRDRTTRLWAPDSPNRSFTEMHCMSGHSNFVSC      1 - 70
VCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKNTVCSLSSGKFGTLLSGSWDTTAKVWLN     71 - 140
DKCMMTLQGHTAAVWAVKILPEQGLMLTGSADKTVKLWKAGRCERTFSGHEDCVRGLAILSETEFLSCAN    141 - 210
DASIRRWQITGECLEVYYGHTNYIYSISVFPNCRDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVL    211 - 280
DNGDIVVGASDGIIRVFTESEDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTRE    281 - 350
GQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPY    351 - 420
NTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPT    421 - 490
ADPFTGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEAVTFDQANPTQILGKLKELNG    491 - 560
TAPEEKKLTEDDLILLEKILSLICNSSSEKPTVQQLQILWKAINCPEDIVFPALDILRLSIKHPSVNENF    561 - 630
CNEKEGAQFSSHLINLLNPKGKPANQLLALRTFCNCFVGQAGQKLMMSQRESLMSHAIELKSGSNKNIHI    631 - 700
ALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDS    701 - 770
QIKKYSSVSEPAKVSECCRFILNLL                                                 771 - 795
//

Text Mined References (27)

PMID Year Title
25448737 2015 Membrane-mediated actions of 1,25-dihydroxy vitamin D3: a review of the roles of phospholipase A2 activating protein and Ca(2+)/calmodulin-dependent protein kinase II.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20185149 2010 Gene variants associated with schizophrenia in a Norwegian genome-wide study are replicated in a large European cohort.
19887378 2010 Structure and function of the PLAA/Ufd3-p97/Cdc48 complex.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19423704 2009 Structural basis for ubiquitin recognition by a novel domain from human phospholipase A2-activating protein.
More...