Property Summary

NCBI Gene PubMed Count 28
PubMed Score 5.40
PubTator Score 4.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Yellow fever 14 3.806 1.9

Expression

Synonym

Accession Q9Y262 B2RDG6 B4DYB2 G8JLH4 Q53HQ1 Q53HT4 Q5QTR1 Q5TI15 Q6ICD2 eIF3l
Symbols EIF3EIP
EIF3S11
HSPC021
HSPC025
MSTP005
EIF3S6IP

Gene

PDB

3J8B   3J8C  

Gene RIF (3)

PMID Text
23800076 These results indicate an interaction of human eIF3L with yellow fever virus NS5 and that eIF3L overexpression facilitates translation, which has potential implications for virus replication.
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit L (EIF3L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit L (EIF3L) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQK      1 - 70
VYELQASRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHI     71 - 140
YAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEE    141 - 210
EIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRL    211 - 280
HSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMF    281 - 350
QRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKF    351 - 420
LSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQL    421 - 490
LVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKM    491 - 560
GQRP                                                                      561 - 564
//

Text Mined References (39)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25416956 2014 A proteome-scale map of the human interactome network.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23800076 2013 The eukaryotic translation initiation factor 3 subunit L protein interacts with Flavivirus NS5 and may modulate yellow fever virus replication.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22190034 2011 Global landscape of HIV-human protein complexes.
More...