Property Summary

NCBI Gene PubMed Count 99
PubMed Score 230.36
PubTator Score 182.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Diaphragmatic Hernia 40
Lung diseases 48
Disease Target Count P-value
lung carcinoma 2844 4.22026590645411E-20
non-small cell lung cancer 2798 5.10615363469901E-19
ovarian cancer 8492 3.30855550913427E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 2.57487754162316E-4
lung cancer 4473 2.62400582272118E-4
medulloblastoma, large-cell 6234 3.04932831255266E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00598501890978007
active ulcerative colitis 477 0.0113169484080368
colon cancer 1475 0.0125213522114346
esophageal adenocarcinoma 737 0.0176010007179145
medulloblastoma 1524 0.0424227966718437
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (11)

Synonym

Accession Q9Y261 Q8WUW4 Q96DF7 HNF-3-beta
Symbols HNF3B
TCF3B

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (81)

PMID Text
27045898 FoxA1, FoxA2, and LIPG control the uptake of extracellular lipids for breast cancer growth.
26929406 Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes.
26658322 The ratio of FoxA1 to FoxA2 in lung adenocarcinoma is regulated by LncRNA HOTAIR and chromatin remodeling factor LSH
26298189 Our results suggest that FOXA2 promotes cell proliferation, maintains cancer stem cells, favors the development of Triple-Negative/Basal-like tumors, and is associated with increase relapses.
26093302 results provide opportunities to understand the FOXA2-centered transcriptional regulation network and novel therapeutic targets to modulate this network in p53-deficient lung cancer
25940296 Expression of FOXA2 is reduced in gastric adenocarcinoma tissues and its low-expression is correlated with malignant clinical pathological features
25921584 FOXA2 regulates a network of genes involved in critical functions of human intestinal epithelial cells.
25843708 DEANR1 facilitates FOXA2 activation by facilitating SMAD2/3 recruitment to the FOXA2 promoter
25836733 FOXA1 and FOXA2 suppressed nuclear hormone receptors, such as HNF4alpha, that are related to HBV replication.
25779673 Study confirmed that FOXA2 inhibited EMT in breast cancer cells by regulating the transcription of EMT-related genes such as E-cadherin and ZEB2.
More...

AA Sequence

MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVG      1 - 70
AGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQA     71 - 140
GLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHS    141 - 210
LSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGA    211 - 280
QASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLL    281 - 350
GPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG    351 - 420
SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS                                     421 - 457
//

Text Mined References (102)

PMID Year Title
27045898 2016 FoxA and LIPG endothelial lipase control the uptake of extracellular lipids for breast cancer growth.
26929406 2016 Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes.
26658322 2015 The ratio of FoxA1 to FoxA2 in lung adenocarcinoma is regulated by LncRNA HOTAIR and chromatin remodeling factor LSH.
26298189 2015 FOXA2 mRNA expression is associated with relapse in patients with Triple-Negative/Basal-like breast carcinoma.
26093302 2015 Transcription factor FOXA2-centered transcriptional regulation network in non-small cell lung cancer.
25940296 2015 [Down-expression of FOXA2 in gastric adenocarcinoma].
25921584 2015 FOXA2 regulates a network of genes involved in critical functions of human intestinal epithelial cells.
25843708 2015 The lncRNA DEANR1 facilitates human endoderm differentiation by activating FOXA2 expression.
25836733 2015 Negative regulation of hepatitis B virus replication by forkhead box protein A in human hepatoma cells.
25779673 2015 FOXA2 attenuates the epithelial to mesenchymal transition by regulating the transcription of E-cadherin and ZEB2 in human breast cancer.
More...