Property Summary

NCBI Gene PubMed Count 114
PubMed Score 256.94
PubTator Score 182.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.105 1.3e-02
colon cancer 2.600 1.3e-02
esophageal adenocarcinoma 1.300 1.8e-02
intraductal papillary-mucinous adenoma (... 1.300 2.6e-04
intraductal papillary-mucinous carcinoma... 1.400 6.0e-03
lung cancer 1.500 2.6e-04
lung carcinoma 1.100 4.2e-20
medulloblastoma 1.200 4.2e-02
medulloblastoma, large-cell 1.200 3.0e-04
non-small cell lung cancer -2.628 3.5e-18
ovarian cancer 1.400 3.3e-08

Gene RIF (96)

AA Sequence

MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVG      1 - 70
AGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQA     71 - 140
GLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHS    141 - 210
LSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGA    211 - 280
QASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLL    281 - 350
GPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG    351 - 420
SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS                                     421 - 457
//

Text Mined References (117)

PMID Year Title