Property Summary

NCBI Gene PubMed Count 33
PubMed Score 54.82
PubTator Score 30.79

Knowledge Summary

Patent (34,763)

Expression

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR      1 - 70
VYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFP     71 - 140
EGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEM    141 - 210
NLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNH    211 - 280
FCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASH    281 - 350
FFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS                             351 - 395
//

Text Mined References (34)

PMID Year Title