Property Summary

NCBI Gene PubMed Count 82
PubMed Score 594.03
PubTator Score 217.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis 2.300 7.1e-05
pituitary cancer -1.900 7.3e-05
uncontrolled asthma 1.600 4.0e-03

Gene RIF (71)

AA Sequence

MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGK      1 - 70
KVCTHPRKKWVQKYISLLKTPKQL                                                   71 - 94
//

Text Mined References (82)

PMID Year Title