Property Summary

NCBI Gene PubMed Count 76
Grant Count 98
R01 Count 28
Funding $17,578,567.38
PubMed Score 563.49
PubTator Score 217.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 1.600 0.004
Atopic dermatitis 2.300 0.000
pituitary cancer -1.900 0.000

Synonym

Accession Q9Y258 A0N0Q5 Q52LV8
Symbols IMAC
TSC-1
MIP-4a
SCYA26
MIP-4alpha

Gene

PDB

1G2S   1G2T  

Gene RIF (65)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of CCL26 in human monocyte-derived dendritic cells
25936567 These results show a relation between CCL26 production by IL-13-stimulated bronchial epithelial cells , sputum eosinophil counts, and asthma severity. They also suggest a role for CCL26 in the sustained inflammation observed in patients with severe eosinophilic asthma and reveal CCL26 as a potential target for treating patients with eosinophilic asthma that are refractory
25323950 The most potent inhibition of RANTES, eotaxin and eotaxin3 as well as MMP9 activity.
24989688 these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family.
24684589 These findings indicate that eotaxin-3 is expressed in Chronic subdural hematoma fluid
24600981 CCL11, CCL24, and CCL26 are increased in TB patients; hence, it seems that TB suppresses Th1 and the classic function of macrophages subsequently by inducing the chemokines' expression
24323578 these data identify a contributory role for DNA methylation in regulating eotaxin-3 production in human allergic inflammation.
23607908 elevated expression in the active lesions of ulcerative colitis and Crohn's disease
23532518 CCL26 is a more effective chemoattractant than CCL11 or CCL24 for eosinophils of asthmatics. All eotaxins induced the eosinophil migration from 0 to 6 h, but CCL26 triggered a second phase of migration between 12 & 18 h.
23477905 CCL11, CCL24, and CCL26 has a role in the recruitment of extravillous trophoblast into decidual tissue and vessels.
More...

AA Sequence

MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGK      1 - 70
KVCTHPRKKWVQKYISLLKTPKQL                                                   71 - 94
//

Text Mined References (76)

PMID Year Title
25936567 2015 Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma.
25323950 2014 Inhibitory activity of Socheongryong?tang and its constituent components against the production of RANTES, eotaxin, eotaxin?3 and MMP?9 from BEAS?2B cells.
24989688 2014 Nasal fluid release of eotaxin-3 and eotaxin-2 in persistent sinonasal eosinophilic inflammation.
24684589 2014 Eotaxin-3 activates the Smad pathway through the transforming growth factor beta 1 in chronic subdural hematoma outer membranes.
24600981 2014 All eotaxins CCL11, CCL24 and CCL26 are increased but to various extents in pulmonary tuberculosis patients.
24323578 2014 Demethylation of the human eotaxin-3 gene promoter leads to the elevated expression of eotaxin-3.
23607908 2013 Regulation of eotaxin-3/CC chemokine ligand 26 expression by T helper type 2 cytokines in human colonic myofibroblasts.
23532518 2013 CCL26/eotaxin-3 is more effective to induce the migration of eosinophils of asthmatics than CCL11/eotaxin-1 and CCL24/eotaxin-2.
23477905 2013 Control of extravillous trophoblast function by the eotaxins CCL11, CCL24 and CCL26.
23185525 2012 Omeprazole blocks STAT6 binding to the eotaxin-3 promoter in eosinophilic esophagitis cells.
More...