Property Summary

NCBI Gene PubMed Count 16
Grant Count 45
R01 Count 17
Funding $6,122,407.05
PubMed Score 334.37
PubTator Score 15.54

Knowledge Summary

Patent (4,115)

Expression

Gene RIF (4)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human potassium channel, subfamily K, member 6 (KCNK6) at amino acid residues 42-43 by the HIV-1 protease
21964404 Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells
20029952 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
14689445 Identification and characterization of Kcnk6 expression within the mammalian cochlea established the gene as a functional candidate for DFNA4.

AA Sequence

MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG      1 - 70
RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA     71 - 140
SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI    141 - 210
SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN    211 - 280
ADEDDRVDILGPQPESHQQLSASSHTDYASIPR                                         281 - 313
//

Text Mined References (16)

PMID Year Title
21964404 2012 A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells.
20029952 2010 Genetic modifiers of the severity of sickle cell anemia identified through a genome-wide association study.
18516069 2008 Regulation of two-pore-domain (K2P) potassium leak channels by the tyrosine kinase inhibitor genistein.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14689445 2004 Genomic structure, cochlear expression, and mutation screening of KCNK6, a candidate gene for DFNA4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256078 2001 Potassium leak channels and the KCNK family of two-P-domain subunits.
10887187 2000 TWIK-2, an inactivating 2P domain K+ channel.
More...