Property Summary

NCBI Gene PubMed Count 16
PubMed Score 358.66
PubTator Score 15.54

Knowledge Summary

Patent (4,115)

Expression

  Differential Expression (9)

Gene RIF (4)

AA Sequence

MRRGALLAGALAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRSPCVAAPALDAFVERVLAAG      1 - 70
RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFALLGVPTTMLLLTA     71 - 140
SAQRLSLLLTHVPLSWLSMRWGWDPRRAACWHLVALLGVVVTVCFLVPAVIFAHLEEAWSFLDAFYFCFI    141 - 210
SLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGLVAMVLVLQTFRHVSDLHGLTELILLPPPCPASFN    211 - 280
ADEDDRVDILGPQPESHQQLSASSHTDYASIPR                                         281 - 313
//

Text Mined References (16)

PMID Year Title