Property Summary

NCBI Gene PubMed Count 14
Grant Count 41
R01 Count 39
Funding $3,885,188.03
PubMed Score 68.60
PubTator Score 30.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.300 0.000

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588848 confirmatory 6 / 3 / 10 Human Ras-Converting Enzyme Inhibition Assay Measured in Biochemical System Using Plate Reader - 2034-04_Inhibitor_Dose_DryPowder_Activity
588849 confirmatory 202 / 14 / 340 Human Ras-Converting Enzyme Inhibition Assay Measured in Biochemical System Using Plate Reader - 2034-04_Inhibitor_Dose_CherryPick_Activity

Gene RIF (5)

PMID Text
26546252 Suggests that expression of Rce1 can serve as an independent biomarker for the prognosis of prostate carcinoma patients.
24134311 A novel RCE1 isoform is required for H-Ras plasma membrane localization regulated by ubiquitin specific peptidase (USP)17.
16361710 the ras converting enzyme requires its glutamate and histidine residues
14504265 CAAX endoprotease Rce1 is required for lamin B1 endoproteolysis
12818187 We found that an 8-aa K-Ras-derived "CAA" peptide, KSKTKC(farnesyl)VI, was a better substrate for hRCE1 than a KSKTKC(f)VIM "CAAX" peptide, hRCE1 has important interaction with the P2' and P3' substrate positions in addition to the farnesylated cysteine

AA Sequence

MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKR      1 - 70
RFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPC     71 - 140
DLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFH    141 - 210
HIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQ    211 - 280
RRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS                         281 - 329
//

Text Mined References (16)

PMID Year Title
26546252 2016 Overexpressed Rce1 is positively correlated with tumor progression and predicts poor prognosis in prostate cancer.
24134311 2014 A novel RCE1 isoform is required for H-Ras plasma membrane localization and is regulated by USP17.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
19946888 2010 Defining the membrane proteome of NK cells.
19188362 2009 USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16361710 2006 Mutational analysis of the ras converting enzyme reveals a requirement for glutamate and histidine residues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14625273 2004 On the physiological importance of endoproteolysis of CAAX proteins: heart-specific RCE1 knockout mice develop a lethal cardiomyopathy.
14504265 2003 A carboxyl-terminal interaction of lamin B1 is dependent on the CAAX endoprotease Rce1 and carboxymethylation.
12818187 2003 Human Ras converting enzyme endoproteolytic specificity at the P2' and P3' positions of K-Ras-derived peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11038283 2000 Human ras-converting enzyme (hRCE1) endoproteolytic activity on K-ras-derived peptides.
10373325 1999 Identification and chromosomal location of two human genes encoding enzymes potentially involved in proteolytic maturation of farnesylated proteins.
10085068 1999 Cloning and characterization of a mammalian prenyl protein-specific protease.