Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 5
Funding $434,532.5
PubMed Score 19.30
PubTator Score 6.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis 1.400 0.000
non primary Sjogren syndrome sicca 1.200 0.017
ovarian cancer 2.200 0.000

Synonym

Accession Q9Y255 B2R5F7 D6RD25 Q549N2 Q9UI13 Q9UJS9
Symbols PX19
PRELI
SBBI12
CGI-106

Gene

Gene RIF (5)

PMID Text
26275693 PRELI plays an important role in the suppression of apoptosis in HepG2 cells in response to oxidative stress.
23931759 Loss of TRIAP1 or PRELI impairs the accumulation of Cardiolipin, facilitates the release of cytochrome c, and renders cells vulnerable to apoptosis upon intrinsic and extrinsic stimulation.
22666421 PRELI is a vital LEA B cell protein with failsafe genetics
21364629 PRELI interacts with OPA1 to maintain mitochondria structures intact, sustain balanced ion(-)/proton(+) gradients, promote oxidative phosphorylation reactions, regulate pro- and antiapoptotic protein traffic and enable cell responses to induced death.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLF      1 - 70
PANVAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVS     71 - 140
RAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAKDLASKAATK    141 - 210
KQQQQQQFV                                                                 211 - 219
//

Text Mined References (17)

PMID Year Title
26275693 2015 Effects of PRELI in Oxidative-Stressed HepG2 Cells.
23931759 2013 TRIAP1/PRELI complexes prevent apoptosis by mediating intramitochondrial transport of phosphatidic acid.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22666421 2012 Spare PRELI gene loci: failsafe chromosome insurance?
21364629 2010 Vital function of PRELI and essential requirement of its LEA motif.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18945965 2009 PRELI is a mitochondrial regulator of human primary T-helper cell apoptosis, STAT6, and Th2-cell differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...