Property Summary

NCBI Gene PubMed Count 125
Grant Count 149
R01 Count 110
Funding $19,571,454.5
PubMed Score 336.55
PubTator Score 116.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.800 0.000
tuberculosis and treatment for 6 months -1.100 0.000
Breast cancer 2.500 0.037
adult high grade glioma 1.100 0.002
group 3 medulloblastoma 1.500 0.000
acute myeloid leukemia 1.300 0.022

Synonym

Accession Q9Y253 Q7L8E3 Q96BC4 Q9BX13
Symbols XPV
XP-V
RAD30
RAD30A

Gene

PDB

2LSK   2I5O   3JAA   3MR2   3MR3   3MR5   3MR6   3SI8   3TQ1   3WUP   4DL2   4DL3   4DL4   4DL5   4DL6   4DL7   4ECQ   4ECR   4ECS   4ECT   4ECU   4ECV   4ECW   4ECX   4ECY   4ECZ   4ED0   4ED1   4ED2   4ED3   4ED6   4ED7   4ED8   4EEY   4J9K   4J9L   4J9M   4J9N   4J9O   4J9P   4J9Q   4J9R   4J9S   4O3N   4O3O   4O3P   4O3Q   4O3R   4O3S   4Q8E   4Q8F   4RNM   4RNN   4RNO   4RU9   4YP3   4YQW   4YR0   4YR2   4YR3   5DG7   5DG8   5DG9   5DGA   5DGB   5DLF   5DLG   5DQG   5DQH   5DQI   5EWE   5EWF   5EWG   5JUM   5KFA   5KFB   5KFC   5KFD   5KFE   5KFF   5KFG   5KFH   5KFI   5KFJ   5KFK   5KFL   5KFM   5KFN   5KFO   5KFP   5KFQ   5KFR   5KFS   5KFT   5KFU   5KFV   5KFW   5KFX   5KFY   5KFZ   5KG0   5KG1   5KG2   5KG3   5KG4   5KG5   5KG6   5KG7   5L9X  

 GO Component (2)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
588591 confirmatory 4746 / 13893 / 373704 qHTS for Inhibitors of Polymerase Eta
588636 summary 0 / 0 / 0 qHTS for Inhibitors of Polymerase Eta: Summary
720502 confirmatory 1696 / 942 / 0 qHTS for Inhibitors of Polymerase Eta: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (105)

PMID Text
26935581 The described is cooperative motion of a key positively charged residue and metal ions for DNA replication catalyzed by human DNA Polymerase eta.
26434497 free energy difference is slightly greater for binding at the 5' thymine position than at the 3' thymine position, presumably because of stabilization arising from the A:T base pair formed at the 3' position of the TTD in previous step of Pol eta function
26170230 Poleta has three PCNA-interacting protein (PIP) boxes (PIP1, 2, 3) that contribute differentially to two distinct functions, stimulation of DNA synthesis and promotion of PCNA ubiquitination.
25947374 Arg-61 and Gln-38 of human DNA polymerase (hpol) eta play important roles in the catalytic reaction.
25831546 ovarian CSCs have intrinsically enhanced Pol eta-mediated translesion DNA synthesis, allowing CSCs to survive cisplatin treatment, leading to tumor relapse
25766642 PolH721 variant present in XP-V patients is unstable. Extra 8 amino acids of PolH721 do not act as degron but induce conformational change of PolH C-terminus exposing its bipartite NLS and sequence close to its UBZ to the ubiquitin/proteasome system.
25666608 Human pol eta, a major copying enzyme with abasic sites, follows a purine rule, which can also lead to frameshifts. The phenomenon can be explained with H-bonds.
25662213 The results show that the FF483-484 amino acids in the human Poleta (designated F1 motif) are necessary for the interaction of this polymerase with POLD2, the B subunit of the replicative DNA polymerase delta, both in vitro and in vivo.
25435364 our findings reveal a modulatory role of USP7 in PCNA ubiquitination-mediated stress-tolerance pathways by fine-tuning Poleta turnover.
25268038 A novel mechanism by which POLH expression is controlled by PCBP1 via mRNA stability.
More...

AA Sequence

MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKK      1 - 70
LCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISAD     71 - 140
LLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGF    141 - 210
QCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQ    211 - 280
FTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEE    281 - 350
RLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT    351 - 420
MLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAER    421 - 490
QKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPWSNC    491 - 560
KALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHNSQSMHASSASKSVLEVTQKATPNPSLLAAE    561 - 630
DQVPCEKCGSLVPVWDMPEHMDYHFALELQKSFLQPHSSNPQVVSAVSHQGKRNPKSPLACTNKRPRPEG    631 - 700
MQTLESFFKPLTH                                                             701 - 713
//

Text Mined References (126)

PMID Year Title
26935581 2016 Cooperative motion of a key positively charged residue and metal ions for DNA replication catalyzed by human DNA Polymerase-?.
26434497 2015 Relative Binding Free Energies of Adenine and Guanine to Damaged and Undamaged DNA in Human DNA Polymerase ?: Clues for Fidelity and Overall Efficiency.
26170230 2015 Different types of interaction between PCNA and PIP boxes contribute to distinct cellular functions of Y-family DNA polymerases.
25947374 2015 Roles of Residues Arg-61 and Gln-38 of Human DNA Polymerase ? in Bypass of Deoxyguanosine and 7,8-Dihydro-8-oxo-2'-deoxyguanosine.
25831546 2015 Enhanced expression of DNA polymerase eta contributes to cisplatin resistance of ovarian cancer stem cells.
25766642 2015 Aberrant C-terminal domain of polymerase ? targets the functional enzyme to the proteosomal degradation pathway.
25666608 2015 Structural and kinetic analysis of nucleoside triphosphate incorporation opposite an abasic site by human translesion DNA polymerase ?.
25662213 2015 FF483-484 motif of human Pol? mediates its interaction with the POLD2 subunit of Pol? and contributes to DNA damage tolerance.
25435364 2015 USP7 modulates UV-induced PCNA monoubiquitination by regulating DNA polymerase eta stability.
25268038 2014 DNA polymerase ? is regulated by poly(rC)-binding protein 1 via mRNA stability.
More...