Property Summary

NCBI Gene PubMed Count 138
PubMed Score 200.29
PubTator Score 116.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.300 2.2e-02
adult high grade glioma 1.100 1.6e-03
Breast cancer 2.500 3.7e-02
group 3 medulloblastoma 1.400 2.1e-03
osteosarcoma 1.800 2.5e-05
tuberculosis and treatment for 6 months -1.100 2.0e-04

Synonym

Accession Q9Y253 Q7L8E3 Q96BC4 Q9BX13
Symbols XPV
XP-V
RAD30
RAD30A

Gene

PDB

2LSK   2I5O   3JAA   3MR2   3MR3   3MR5   3MR6   3SI8   3TQ1   3WUP   4DL2   4DL3   4DL4   4DL5   4DL6   4DL7   4ECQ   4ECR   4ECS   4ECT   4ECU   4ECV   4ECW   4ECX   4ECY   4ECZ   4ED0   4ED1   4ED2   4ED3   4ED6   4ED7   4ED8   4EEY   4J9K   4J9L   4J9M   4J9N   4J9O   4J9P   4J9Q   4J9R   4J9S   4O3N   4O3O   4O3P   4O3Q   4O3R   4O3S   4Q8E   4Q8F   4RNM   4RNN   4RNO   4RU9   4YP3   4YQW   4YR0   4YR2   4YR3   5DG7   5DG8   5DG9   5DGA   5DGB   5DLF   5DLG   5DQG   5DQH   5DQI   5EWE   5EWF   5EWG   5F9L   5F9N   5JUM   5KFA   5KFB   5KFC   5KFD   5KFE   5KFF   5KFG   5KFH   5KFI   5KFJ   5KFK   5KFL   5KFM   5KFN   5KFO   5KFP   5KFQ   5KFR   5KFS   5KFT   5KFU   5KFV   5KFW   5KFX   5KFY   5KFZ   5KG0   5KG1   5KG2   5KG3   5KG4   5KG5   5KG6   5KG7   5L1I   5L1J   5L1K   5L1L   5L9X  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Protein-protein Interaction (5)

Gene RIF (118)

AA Sequence

MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKK      1 - 70
LCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISAD     71 - 140
LLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGF    141 - 210
QCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQ    211 - 280
FTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEE    281 - 350
RLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT    351 - 420
MLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQKAAER    421 - 490
QKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPWSNC    491 - 560
KALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHNSQSMHASSASKSVLEVTQKATPNPSLLAAE    561 - 630
DQVPCEKCGSLVPVWDMPEHMDYHFALELQKSFLQPHSSNPQVVSAVSHQGKRNPKSPLACTNKRPRPEG    631 - 700
MQTLESFFKPLTH                                                             701 - 713
//

Text Mined References (140)

PMID Year Title