Property Summary

NCBI Gene PubMed Count 275
Grant Count 55
R01 Count 38
Funding $6,417,738.13
PubMed Score 852.36
PubTator Score 619.79

Knowledge Summary

Patent

No data available

Expression

 IMPC Term (1)

Gene RIF (249)

PMID Text
26745132 higher heparanase expression in gastric cancer is associated with clinicopathologic features of depth of invasion, lymph node metastasis.
26720478 Our findings suggest a link between heparanase, syndecan-1, and VEGF in the progression of PDR and that heparanase is a potential target for therapy of diabetic retinopathy.
26713365 Taken together, it is concluded that colon 26 cells transduce the heparanase-mediated signal through heparan sulfate binding.
26575439 The authors present crystal structures of human HPSE at 1.6-A to 1.9-A resolution that reveal how an endo-acting binding cleft is exposed by proteolytic activation of latent proHPSE.
26552066 Studies indicate that heparanase (HPSE) has been a potential target of medical treatment.
26489695 JAK-2 V617F mutation results in heparanase up-regulation via the erythropoietin receptor.
26249176 Heparanase resides within autophagosomes. Heparanase-overexpressing cells were more resistant to stress and chemotherapy in a manner associated with increased autophagy.
26039697 heparanase contributes to allergen-induced eosinophil recruitment to the lung.
25944690 Report FGF23/klotho/heparanase signaling axis active in multiple myeloma.
25912399 upregulated through NF-kB and translocated to the cell surface upon herpes simplex virus-1 infection for the removal of heparan sulfate to facilitate viral release
More...

AA Sequence

MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPR      1 - 70
FLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQSQVNQDICKYGSIPPDVEEKL     71 - 140
RLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDY    141 - 210
CSSKGYNISWELGNEPNSFLKKADIFINGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLK    211 - 280
SFLKAGGEVIDSVTWHHYYLNGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGG    281 - 350
GAPLLSDTFAAGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM    351 - 420
ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLLRPLGPHGLLS    421 - 490
KSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVAACI                     491 - 543
//

Text Mined References (280)

PMID Year Title
26745132 2015 Heparanase mRNA and Protein Expression Correlates with Clinicopathologic Features of Gastric Cancer Patients: a Meta- analysis.
26720478 2015 Upregulated Expression of Heparanase in the Vitreous of Patients With Proliferative Diabetic Retinopathy Originates From Activated Endothelial Cells and Leukocytes.
26713365 2016 Heparanase augments inflammatory chemokine production from colorectal carcinoma cell lines.
26575439 2015 Structural characterization of human heparanase reveals insights into substrate recognition.
26552066 2015 Recent data concerning heparanase: focus on fibrosis, inflammation and cancer.
26489695 2016 JAK-2 V617F mutation increases heparanase procoagulant activity.
26249176 2015 Heparanase Enhances Tumor Growth and Chemoresistance by Promoting Autophagy.
26039697 2015 The role of heparanase in pulmonary cell recruitment in response to an allergic but not non-allergic stimulus.
25944690 2015 FGF23 is elevated in multiple myeloma and increases heparanase expression by tumor cells.
25912399 2015 Heparanase is a host enzyme required for herpes simplex virus-1 release from cells.
More...