Property Summary

NCBI Gene PubMed Count 30
PubMed Score 38.36
PubTator Score 36.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.300 4.3e-03
atypical teratoid / rhabdoid tumor -1.400 2.0e-02
Breast cancer 2.300 2.7e-02
cystic fibrosis -1.329 2.4e-05
ependymoma -1.500 4.4e-03
intraductal papillary-mucinous adenoma (... -1.800 3.8e-04
intraductal papillary-mucinous carcinoma... -1.600 1.5e-03
malignant mesothelioma 2.300 6.7e-07
oligodendroglioma -1.100 1.6e-02
ovarian cancer 2.000 1.9e-05

Gene RIF (18)

AA Sequence

MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKV      1 - 70
SQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKGAVRPTAFKPVLPRSGAILHS     71 - 140
SPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMSSLPTHSTSSSYQLDPLVTPVGPTSRFGGSA    141 - 210
HNITQGIVLQDSNMMSLKALSFSDGGSKLGHSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKL    211 - 280
QRSFEEKELASSLAYEERPRRCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELE    281 - 350
SLMKEQDLLETKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLK    351 - 420
DTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGP    421 - 490
PTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRL    491 - 560
EKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI                                      561 - 596
//

Text Mined References (32)

PMID Year Title