Property Summary

NCBI Gene PubMed Count 30
Grant Count 1
Funding $134,778
PubMed Score 38.32
PubTator Score 36.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 4.500 0.000
astrocytic glioma -2.500 0.002
ependymoma -2.600 0.003
oligodendroglioma -1.800 0.008
cystic fibrosis -2.124 0.000
atypical teratoid / rhabdoid tumor -1.400 0.020
intraductal papillary-mucinous adenoma (... -1.800 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.002
Breast cancer 2.300 0.027
ovarian cancer 2.000 0.000

Synonym

Accession Q9Y250 D3DSQ6 Q9Y5V7 Q9Y5V8 Q9Y5V9 Q9Y5W0 Q9Y5W1 Q9Y5W2
Symbols F37
FEZ1

Gene

 Grant Application (1)

Gene RIF (18)

PMID Text
26653561 Compared with the normal hepatocyte cells, LZTS1 expression in hepatocellular carcinoma cells was significantly lower
26504261 missense variant in the LZTS1 gene was identified in two Ehlers-Danlos syndrome patients in an extended family.
25938461 miR-135b expression inversely correlated with LZTS1 staining intensity and the Cutaneous Squamous Cell Carcinoma grade.
25813822 LZTS1 promoter was frequently methylated in IMPC samples.
25667121 Suggest that LZTS1 plays a potential tumor suppressor role in colorectal cancer progression and represents a valuable clinical prognostic marker of this disease.
24802407 miR-214 functions as an onco-miRNA in osteosarcoma, and its oncogenic effects are mediated chiefly through downregulation of LZTS1
24448468 Lzts1 was significantly downregulated in breast cancer samples and its deregulation was associated with a higher incidence of tumor recurrence, and to a worse overall survival.
23695671 Expression of miR-135b, LZTS1, LATS2 and nuclear TAZ predicts poor outcomes of non-small-cell lung cancer.
21419475 Lower levels of leucine zipper putative tumor suppressor 1 correlated with high histologic grade, lymph node metastasis, and poor prognosis.
20508983 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGSVSSLISGHSFHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKV      1 - 70
SQKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMPFSNQLEMGSEKGAVRPTAFKPVLPRSGAILHS     71 - 140
SPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMSSLPTHSTSSSYQLDPLVTPVGPTSRFGGSA    141 - 210
HNITQGIVLQDSNMMSLKALSFSDGGSKLGHSNKADKGPSCVRSPISTDECSIQELEQKLLEREGALQKL    211 - 280
QRSFEEKELASSLAYEERPRRCRDELEGPEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELE    281 - 350
SLMKEQDLLETKLRSYEREKTSFGPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGLKAQLK    351 - 420
DTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGP    421 - 490
PTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRL    491 - 560
EKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI                                      561 - 596
//

Text Mined References (32)

PMID Year Title
26653561 2015 The tumor-suppressor gene LZTS1 suppresses hepatocellular carcinoma proliferation by impairing PI3K/Akt pathway.
26504261 2015 Ehlers-Danlos Syndrome, Hypermobility Type, Is Linked to Chromosome 8p22-8p21.1 in an Extended Belgian Family.
25938461 2015 MicroRNA-135b Regulates Leucine Zipper Tumor Suppressor 1 in Cutaneous Squamous Cell Carcinoma.
25813822 2015 Loss of Leucine Zipper Putative Tumor Suppressor 1 (LZTS1) Expression Contributes to Lymph Node Metastasis of Breast Invasive Micropapillary Carcinoma.
25667121 2015 The tumor-suppressor gene LZTS1 suppresses colorectal cancer proliferation through inhibition of the AKT-mTOR signaling pathway.
24802407 2014 miR-214 promotes the proliferation and invasion of osteosarcoma cells through direct suppression of LZTS1.
24448468 2014 LZTS1 downregulation confers paclitaxel resistance and is associated with worse prognosis in breast cancer.
23695671 2013 MicroRNA-135b promotes lung cancer metastasis by regulating multiple targets in the Hippo pathway and LZTS1.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
More...