Property Summary

NCBI Gene PubMed Count 20
PubMed Score 57.17
PubTator Score 36.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -1.400 6.3e-03
adrenocortical carcinoma 1.789 6.8e-06
adult high grade glioma 1.300 3.3e-03
atypical teratoid / rhabdoid tumor 2.500 5.9e-09
Breast cancer 1.500 3.2e-08
breast carcinoma 1.200 1.1e-03
ductal carcinoma in situ 1.900 1.3e-02
Endometriosis 1.373 3.1e-02
glioblastoma 1.800 7.9e-08
group 3 medulloblastoma 3.200 2.5e-08
intraductal papillary-mucinous carcinoma... 1.600 2.9e-03
intraductal papillary-mucinous neoplasm ... 2.300 5.7e-04
invasive ductal carcinoma 2.900 1.4e-03
lung adenocarcinoma 1.100 4.6e-08
lung cancer 3.400 1.6e-05
lung carcinoma 2.500 1.1e-21
medulloblastoma, large-cell 2.800 3.8e-06
non-small cell lung cancer 2.715 8.9e-30
osteosarcoma 1.177 3.1e-06
ovarian cancer 1.300 3.7e-04
pituitary cancer 1.100 9.4e-05
posterior fossa group A ependymoma 1.300 1.5e-05
primitive neuroectodermal tumor 2.800 1.2e-05
psoriasis 1.200 5.3e-30

Gene RIF (7)

AA Sequence

MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK      1 - 70
LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE     71 - 140
AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF                             141 - 185
//

Text Mined References (32)

PMID Year Title