Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $154,176.33
PubMed Score 49.32
PubTator Score 36.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y248 D3DUM5 Q6IAG9
Symbols PSF2
Pfs2
HSPC037

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

2E9X   2EHO   2Q9Q  

Gene RIF (5)

PMID Text
25348432 High GINS2 transcript level is associated with endocrine therapy resistance in beast cancer.
24273454 On the contrary, after HL60 cells were infected by recombinant adenovirus vector which contained GINS2 gene, we observed that over-expression of GINS2 could promote HL-60 cell proliferation.
23589040 GINS2 plays an important role in apoptosis and may function via the p38MAPK signaling pathway.
22474384 Data show that using a 200-nt primed circular DNA substrate, the combined action of DNA polymerase epsilon and the Cdc45/Mcm2-7/GINS (CMG complex) leads to the formation of products >10 kb in length.
21082043 Data suggest that GINS2 to be associated with the aggressive characteristics of a subgroup of breast cancers in vivo.

AA Sequence

MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEK      1 - 70
LEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQE     71 - 140
AHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF                             141 - 185
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25348432 2014 High GINS2 transcript level predicts poor prognosis and correlates with high histological grade and endocrine therapy resistance through mammary cancer stem cells in breast cancer patients.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
24273454 2013 Effect of GINS2 on proliferation and apoptosis in leukemic cell line.
23589040 2013 Roles of GINS2 in K562 human chronic myelogenous leukemia and NB4 acute promyelocytic leukemia cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22474384 2012 Properties of the human Cdc45/Mcm2-7/GINS helicase complex and its action with DNA polymerase epsilon in rolling circle DNA synthesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...