Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.37
PubTator Score 3.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.400 3.6e-03
atypical teratoid / rhabdoid tumor -1.100 4.7e-05
ependymoma -1.800 3.9e-02
glioblastoma -1.200 2.4e-04
intraductal papillary-mucinous neoplasm ... -1.500 2.1e-03
malignant mesothelioma -1.200 7.8e-07
oligodendroglioma -1.900 1.6e-02
pediatric high grade glioma -1.200 3.0e-04
primitive neuroectodermal tumor -1.800 4.0e-03
subependymal giant cell astrocytoma -1.197 2.1e-02

Synonym

Accession Q9Y247 Q5T2L6
Symbols X5L
D6S2654E

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

AA Sequence

MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTL      1 - 70
NDMKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAG     71 - 140
NLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAQREKVKDEEMEVTFSYWDGSGHRRTVRVRKGNTVQ    141 - 210
QFLKKALQGLRKDFLELRSAGVEQLMFIKEDLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDA    211 - 280
TMEKDESHAGKVVLRSWYEKNKHIFPASRWEAYDPEKKWDKYTIR                             281 - 325
//

Text Mined References (17)

PMID Year Title