Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.27
PubTator Score 3.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

AA Sequence

MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTL      1 - 70
NDMKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAG     71 - 140
NLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAQREKVKDEEMEVTFSYWDGSGHRRTVRVRKGNTVQ    141 - 210
QFLKKALQGLRKDFLELRSAGVEQLMFIKEDLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDA    211 - 280
TMEKDESHAGKVVLRSWYEKNKHIFPASRWEAYDPEKKWDKYTIR                             281 - 325
//

Text Mined References (16)

PMID Year Title
26198301 2015 Expression of imprinted genes in placenta is associated with infant neurobehavioral development.
26003415 2015 Array-based DNA methylation analysis in individuals with developmental delay/intellectual disability and normal molecular karyotype.
25416956 2014 A proteome-scale map of the human interactome network.
24130816 2013 Deep bisulfite sequencing of aberrantly methylated loci in a patient with multiple methylation defects.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21593219 2011 Methylation screening of reciprocal genome-wide UPDs identifies novel human-specific imprinted genes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21421564 2011 Novel retrotransposed imprinted locus identified at human 6p25.
19060904 2009 An empirical framework for binary interactome mapping.
More...