Property Summary

NCBI Gene PubMed Count 21
Grant Count 20
R01 Count 5
Funding $2,776,487.25
PubMed Score 40.82
PubTator Score 66.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
active Crohn's disease 1.133 0.024
ovarian cancer 2.200 0.000

Gene RIF (8)

PMID Text
26483548 studies validate a role for the NRF2/POMP axis in bortezomib resistance and identify NRF2 and POMP as potentially attractive targets for chemosensitization to this proteasome inhibitor
26145175 microRNA-101 (miR-101) targets the proteasome maturation protein POMP, leading to impaired proteasome assembly and activity, and resulting in accumulation of p53 and cyclin-dependent kinase inhibitors, cell cycle arrest, and apoptosis.
24080446 Single-nucleotide polymorphisms in POMP gene is associated with breast cancer risk after menopausal hormone replacement therapy.
22235297 KLICK is caused by reduced levels of POMP, leading to proteasome insufficiency in differentiating keratinocytes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20226437 A single-nucleotide deletion in the POMP 5' UTR causes a transcriptional switch and altered epidermal proteasome distribution in KLICK genodermatosis.
17948026 Data show that POMP facilitates the main steps in 20S core complex formation at the ER to coordinate the assembly process and to provide cells with freshly formed proteasomes at their site of function.
16624403 POMP/proteassemblin/hUmp1 may be tetramerised and is localized to the cytoplasm and the nucleus

AA Sequence

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI      1 - 70
QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL     71 - 140
L//

Text Mined References (23)

PMID Year Title
26483548 2015 The Nuclear Factor (Erythroid-derived 2)-like 2 and Proteasome Maturation Protein Axis Mediate Bortezomib Resistance in Multiple Myeloma.
26145175 2015 MicroRNA-101 Suppresses Tumor Cell Proliferation by Acting as an Endogenous Proteasome Inhibitor via Targeting the Proteasome Assembly Factor POMP.
24080446 2013 Genetic modifiers of menopausal hormone replacement therapy and breast cancer risk: a genome-wide interaction study.
22235297 2012 siRNA silencing of proteasome maturation protein (POMP) activates the unfolded protein response and constitutes a model for KLICK genodermatosis.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20226437 2010 A single-nucleotide deletion in the POMP 5' UTR causes a transcriptional switch and altered epidermal proteasome distribution in KLICK genodermatosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17948026 2007 The proteasome maturation protein POMP facilitates major steps of 20S proteasome formation at the endoplasmic reticulum.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
More...