Property Summary

NCBI Gene PubMed Count 22
PubMed Score 42.47
PubTator Score 66.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.133 2.4e-02
hepatocellular carcinoma 1.100 2.9e-04
ovarian cancer 2.200 3.0e-05

Gene RIF (9)

AA Sequence

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI      1 - 70
QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL     71 - 140
L//

Text Mined References (25)

PMID Year Title