Property Summary

NCBI Gene PubMed Count 116
Grant Count 113
R01 Count 84
Funding $9,374,672.61
PubMed Score 460.54
PubTator Score 111.02

Knowledge Summary

Patent (35,454)

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Epilepsy 346 5.828 2.9
Incontinentia pigmenti achromians 6 5.661 2.8
Proteus syndrome 6 5.195 2.6
Lissencephaly 61 5.02 2.5
Tuberous sclerosis 18 5.0 2.5
Klippel-Trenaunay syndrome 15 4.947 2.5
Intellectual disability 573 4.047 2.0
Cancer 2,346 3.974 2.0
Lipomatosis 11 3.912 2.0
Hydrocephalus 60 3.896 1.9
Ganglioglioma 16 3.763 1.9
Encephalitis 54 3.719 1.9
Fleck corneal dystrophy 9 3.703 1.9
Periventricular nodular heterotopia 25 3.664 1.8
Hemiplegia 15 3.618 1.8
Microcephaly 149 3.617 1.8
Dysembryoplastic neuroepithelial tumor 10 3.573 1.8
Porencephaly 8 3.404 1.7
Holoprosencephaly 52 3.321 1.7
Hydranencephaly 11 3.264 1.6
Aicardi syndrome 15 3.037 1.5
Breast cancer 3,094
Heart conduction disease 65 1.0
Hemimegalencephaly 2
MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYL... 1 
Malformations of Cortical Development 11
Megalanecephaly Polymicrogyria-Polydacty... 4 
Schizophrenia 501
acute myeloid leukemia 780
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
colon cancer 1,475
cystic fibrosis 1,665
glioblastoma multiforme 347
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non primary Sjogren syndrome sicca 840
non-small cell lung carcinoma 413
osteosarcoma 7,933
ovarian cancer 8,484
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
psoriasis 6,685
spina bifida 1,064
tuberculosis and treatment for 6 months 686
ulcerative colitis 2,087

Expression

Synonym

Accession Q9Y243 Q0VAA6 Q5VTI1 Q5VTI2 Q96QV3 Q9UFP5
Symbols MPPH
PKBG
MPPH2
PRKBG
STK-2
PKB-GAMMA
RAC-gamma
RAC-PK-gamma

Gene

PDB

2X18  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (115)

PMID Text
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26741489 Downregulation of AKT3 increases migration and metastasis in triple negative breast cancer cells by upregulating S100A4.
26523971 These findings suggest a central AKT-FOXG1-reelin signaling pathway in focal malformations of cortical development and support pathway inhibitors as potential treatments or therapies for some forms of focal epilepsy.
26512921 High AKT3 expression is associated with ovarian cancer.
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26318033 AKT3 has a role in prostate cancer proliferation through regulation of Akt, B-Raf, and TSC1/TSC2
26315541 mirn424 has a role in inhibiting Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma
26206082 Flot-2 exerts a pro-neoplastic role in NPC and is involved in tumor progression and metastasis. Moreover, Flot-2 exerts its role through NF-kappaB and PI3K/Akt3 signaling.
26002580 miR-582-5p regulated the progression of hepatocellular carcinoma through directly inhibiting the expression of CDK1 and AKT3, and indirectly inhibiting the expression of cyclinD1
25737557 Akt3-expressing human glioblastoma cells had enhanced activation of DNA repair proteins, leading to increased DNA repair and subsequent resistance to radiation and temozolomide.
More...

AA Sequence

MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPN      1 - 70
TFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHH     71 - 140
KRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTS    141 - 210
LKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLD    211 - 280
KDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD    281 - 350
HEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP    351 - 420
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE               421 - 479
//

Text Mined References (126)

PMID Year Title
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26741489 2016 Downregulation of AKT3 Increases Migration and Metastasis in Triple Negative Breast Cancer Cells by Upregulating S100A4.
26523971 2015 An AKT3-FOXG1-reelin network underlies defective migration in human focal malformations of cortical development.
26512921 2015 MicroRNA-29B (mir-29b) regulates the Warburg effect in ovarian cancer by targeting AKT2 and AKT3.
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26318033 2015 AKT3 promotes prostate cancer proliferation cells through regulation of Akt, B-Raf, and TSC1/TSC2.
26315541 2015 MicroRNA-424 inhibits Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma.
26206082 2015 Flotillin-2 promotes metastasis of nasopharyngeal carcinoma by activating NF-?B and PI3K/Akt3 signaling pathways.
26002580 2015 miR-582-5p inhibits proliferation of hepatocellular carcinoma by targeting CDK1 and AKT3.
25737557 2015 Genomically amplified Akt3 activates DNA repair pathway and promotes glioma progression.
More...