Property Summary

Ligand Count 78
NCBI Gene PubMed Count 140
PubMed Score 489.04
PubTator Score 111.02

Knowledge Summary

Patent (35,454)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.4

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia -3.100 1.7e-02
adrenocortical carcinoma -1.172 1.6e-02
adult high grade glioma -1.300 5.4e-04
Breast cancer -1.800 2.3e-07
colon cancer -2.000 3.2e-02
cystic fibrosis -1.114 4.8e-05
glioblastoma -1.100 1.3e-02
group 3 medulloblastoma 1.300 1.5e-02
intraductal papillary-mucinous adenoma (... -2.700 2.8e-05
intraductal papillary-mucinous carcinoma... -3.100 3.1e-05
intraductal papillary-mucinous neoplasm ... -2.100 1.2e-02
invasive ductal carcinoma -1.900 5.1e-04
lung adenocarcinoma -1.300 2.1e-09
lung cancer 1.300 4.3e-02
medulloblastoma, large-cell 1.500 1.3e-02
nasopharyngeal carcinoma 1.300 3.3e-04
non primary Sjogren syndrome sicca -1.400 2.3e-02
non-small cell lung carcinoma -1.300 2.3e-31
osteosarcoma -2.164 5.1e-04
ovarian cancer -2.300 4.6e-08
pituitary cancer 1.200 4.5e-09
posterior fossa group B ependymoma -1.200 2.9e-06
psoriasis -1.200 2.5e-05
spina bifida 1.176 3.7e-02
tuberculosis and treatment for 3 months -1.100 1.5e-04
ulcerative colitis 1.300 5.0e-05

Gene RIF (134)

AA Sequence

MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPN      1 - 70
TFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHH     71 - 140
KRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTS    141 - 210
LKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLD    211 - 280
KDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD    281 - 350
HEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP    351 - 420
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE               421 - 479
//

Text Mined References (149)

PMID Year Title