Property Summary

NCBI Gene PubMed Count 116
PubMed Score 460.54
PubTator Score 111.02

Knowledge Summary

Patent (35,454)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.33919731067985E-31
glioblastoma multiforme 347 2.14726514509072E-20
Breast cancer 3099 1.28831719679406E-14
ovarian cancer 8492 1.11998736629935E-11
lung adenocarcinoma 2714 5.50223473244509E-10
pituitary cancer 1972 4.53218272805474E-9
posterior fossa group B ependymoma 1530 2.87914252532176E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.75416196364114E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.08137867268123E-5
cystic fibrosis 1670 4.76174861730681E-5
ulcerative colitis 2087 4.99379097118433E-5
adrenocortical carcinoma 1427 2.29677896339292E-4
tuberculosis and treatment for 6 months 686 3.04096663938693E-4
nasopharyngeal carcinoma 1056 3.2848607659162E-4
invasive ductal carcinoma 2950 5.0540614792272E-4
osteosarcoma 7933 5.09155094332153E-4
psoriasis 6685 5.20054929144685E-4
adult high grade glioma 2148 5.43424403564696E-4
lung cancer 4473 0.00205769717702274
group 4 medulloblastoma 1875 0.0030278525151727
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0124539020260629
medulloblastoma, large-cell 6234 0.0129914927589613
acute myeloid leukemia 785 0.0174495234921787
non primary Sjogren syndrome sicca 840 0.0225636768517524
colon cancer 1475 0.0315992141765078
spina bifida 1064 0.0373708376733857
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0

Expression

Synonym

Accession Q9Y243 Q0VAA6 Q5VTI1 Q5VTI2 Q96QV3 Q9UFP5
Symbols MPPH
PKBG
MPPH2
PRKBG
STK-2
PKB-GAMMA
RAC-gamma
RAC-PK-gamma

Gene

PDB

2X18  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (111)

PMID Text
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26741489 Downregulation of AKT3 increases migration and metastasis in triple negative breast cancer cells by upregulating S100A4.
26523971 These findings suggest a central AKT-FOXG1-reelin signaling pathway in focal malformations of cortical development and support pathway inhibitors as potential treatments or therapies for some forms of focal epilepsy.
26512921 High AKT3 expression is associated with ovarian cancer.
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26318033 AKT3 has a role in prostate cancer proliferation through regulation of Akt, B-Raf, and TSC1/TSC2
26315541 mirn424 has a role in inhibiting Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma
26206082 Flot-2 exerts a pro-neoplastic role in NPC and is involved in tumor progression and metastasis. Moreover, Flot-2 exerts its role through NF-kappaB and PI3K/Akt3 signaling.
26002580 miR-582-5p regulated the progression of hepatocellular carcinoma through directly inhibiting the expression of CDK1 and AKT3, and indirectly inhibiting the expression of cyclinD1
25737557 Akt3-expressing human glioblastoma cells had enhanced activation of DNA repair proteins, leading to increased DNA repair and subsequent resistance to radiation and temozolomide.
More...

AA Sequence

MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPN      1 - 70
TFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHH     71 - 140
KRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTS    141 - 210
LKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLD    211 - 280
KDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD    281 - 350
HEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP    351 - 420
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE               421 - 479
//

Text Mined References (126)

PMID Year Title
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26741489 2016 Downregulation of AKT3 Increases Migration and Metastasis in Triple Negative Breast Cancer Cells by Upregulating S100A4.
26523971 2015 An AKT3-FOXG1-reelin network underlies defective migration in human focal malformations of cortical development.
26512921 2015 MicroRNA-29B (mir-29b) regulates the Warburg effect in ovarian cancer by targeting AKT2 and AKT3.
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26318033 2015 AKT3 promotes prostate cancer proliferation cells through regulation of Akt, B-Raf, and TSC1/TSC2.
26315541 2015 MicroRNA-424 inhibits Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma.
26206082 2015 Flotillin-2 promotes metastasis of nasopharyngeal carcinoma by activating NF-?B and PI3K/Akt3 signaling pathways.
26002580 2015 miR-582-5p inhibits proliferation of hepatocellular carcinoma by targeting CDK1 and AKT3.
25737557 2015 Genomically amplified Akt3 activates DNA repair pathway and promotes glioma progression.
More...