Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.17
PubTator Score 130.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.500 3.9e-04
atypical teratoid / rhabdoid tumor 2.000 6.3e-08
Breast cancer 1.100 2.9e-06
ependymoma 1.100 2.1e-09
glioblastoma 1.700 6.9e-09
group 3 medulloblastoma 1.900 8.7e-05
medulloblastoma, large-cell 1.900 1.4e-04
non-small cell lung cancer 1.420 1.3e-18
ovarian cancer 1.100 1.1e-05
primitive neuroectodermal tumor 1.600 5.9e-04

Gene RIF (7)

AA Sequence

MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWR      1 - 70
VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFMFQQVRVKPQDFAAITIPRSR     71 - 140
GEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQPLTFSPSWGGPKSLPVPAPPGE    141 - 210
MGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAP    211 - 280
MAPPAVGGGEPCAAPCCCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT         281 - 345
//

Text Mined References (23)

PMID Year Title