Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.28
PubTator Score 130.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (6)

PMID Text
23860123 Data shows increased apoptosis and susceptibility to endoplasmic reticulum (ER) stress after Tcf19 knockdown.
23860123 Knockdown of Tcf19 reduces proliferation and increases apoptosis. Tcf19 is found in pancreatic islets in mouse and human.
23760081 Genome association studies identified TCF19 as a new risk-associated loci for chronic hepatitis B on the HLA region of chromosome 6.
21076979 A linkage disequilibrium analysis established TCF19, POU5F1, CCHCR1 and PSORS1C1 as potential causal genes for the type 1 diabetes.
20587610 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWR      1 - 70
VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFMFQQVRVKPQDFAAITIPRSR     71 - 140
GEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIGSLSKLRPQPLTFSPSWGGPKSLPVPAPPGE    141 - 210
MGTTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAP    211 - 280
MAPPAVGGGEPCAAPCCCLPQEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT         281 - 345
//

Text Mined References (21)

PMID Year Title
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23955597 2013 Common variation at 3q26.2, 6p21.33, 17p11.2 and 22q13.1 influences multiple myeloma risk.
23860123 2013 Tcf19 is a novel islet factor necessary for proliferation and survival in the INS-1 ?-cell line.
23760081 2013 A genome-wide association study identified new variants associated with the risk of chronic hepatitis B.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21801394 2011 Genome-wide association study of Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis in Europe.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
21076979 2011 Conditional meta-analysis stratifying on detailed HLA genotypes identifies a novel type 1 diabetes locus around TCF19 in the MHC.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
More...