Property Summary

NCBI Gene PubMed Count 24
PubMed Score 38.92
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTV      1 - 70
EGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELT     71 - 140
QGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGS    141 - 210
LAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASP    211 - 280
HPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF                               281 - 323
//

Text Mined References (26)

PMID Year Title