Property Summary

NCBI Gene PubMed Count 23
Grant Count 9
Funding $3,860,911.34
PubMed Score 34.72
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26564003 Data show that asymptomatic patients with unstable plaques exhibited higher levels of endothelial microparticles (EMPs), CXCL9 chemokine and stem cell growth factor; lymphocyte secreted C-type lectin (SCGF-beta) compared to those with stable plaques.
26440592 level of expression correlates with pain response in subjects with intervertebral disc disorders
23357302 This is the first report of SCGF beta in heart failure patients.
21943129 These studies highlight a possible role of SCGFalpha in imatinib-induced changes of gastrointestinal stromal tumors structure, consistent with a therapeutic response.
19884328 The results presented here demonstrate that homozygous T at -539 in the SCGF promoter is associated with elevated SCGF production, enhanced erythropoiesis, and protection against severe malarial anemia.
19528216 phagocytosis of hemozoin promotes a decrease in SCGF gene products, which may contribute to reduced erythropoiesis in children with severe malarial anemia.
19416273 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15234225 Human vascular smooth muscle cells express stem cell factor(SCF) and its receptor, c-kit. SCF is released from its membrane-bound form via MMP-9. SCF/c-kit signaling may affect SMC function via an autocrine pathway.
14746805 Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells.
11920266 SCGF is selectively produced by osseous and hematopoietic stromal cells, and can mediate their proliferative activity on primitive hematopoietic progenitor cells.

AA Sequence

MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTV      1 - 70
EGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELT     71 - 140
QGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGS    141 - 210
LAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASP    211 - 280
HPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF                               281 - 323
//

Text Mined References (25)

PMID Year Title
26564003 2015 Elevated levels of endothelial-derived microparticles, and serum CXCL9 and SCGF-? are associated with unstable asymptomatic carotid plaques.
26440592 2015 Exploratory study for identifying systemic biomarkers that correlate with pain response in patients with intervertebral disc disorders.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23357302 2013 Prognostic value of circulating levels of stem cell growth factor beta (SCGF beta) in patients with Chagas' disease and idiopathic dilated cardiomyopathy.
21943129 2011 Proteomic detection of a large amount of SCGF? in the stroma of GISTs after imatinib therapy.
19884328 2010 A novel functional variant in the stem cell growth factor promoter protects against severe malarial anemia.
19528216 2009 Suppression of a novel hematopoietic mediator in children with severe malarial anemia.
19416273 2009 Association study between keratinocyte-derived growth factor gene polymorphisms and susceptibility to vitiligo vulgaris in a Taiwanese population: potential involvement of stem cell factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...