Property Summary

NCBI Gene PubMed Count 181
Grant Count 125
R01 Count 76
Funding $9,876,367.16
PubMed Score 287.95
PubTator Score 216.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 0.003
subependymal giant cell astrocytoma 1.019 0.022
lung carcinoma -1.200 0.000

Synonym

Accession Q9Y239 B4DTU3 Q549U4 Q8IWF5
Symbols CARD4
NLRC1
CLR7.1

Gene

PDB

4JQW   2B1W   2DBD   2NSN   2NZ7   4E9M  

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
1575 summary 2 / 0 / 0 Summary assay for the identification of compounds that inhibit NOD1
1578 confirmatory 3000 / 0 / 286584 uHTS luminescence assay for the identification of compounds that inhibit NOD1
2255 confirmatory 0 / 0 / 7 SAR analysis of NF-kB dependent luciferase using Doxorucibin as an inducer
2261 confirmatory 0 / 0 / 7 SAR analysis of NF-kB dependent luciferase using PMA/Ionomycin as an inducer
2264 confirmatory 5 / 0 / 2 SAR analysis of NF-kB dependent luciferase using DAP as an inducer
2333 confirmatory 199 / 0 / 104 SAR analysis of compounds that inhibit NOD1 revised
2466 confirmatory 17 / 0 / 3 SAR analysis of compounds that inhibit NOD1 - Set 2
2789 confirmatory 1 / 0 / 15 SAR analysis of NF-kappaB dependent luciferase using Doxorucibin as an inducer - Set 2
2792 confirmatory 2 / 0 / 14 SAR analysis of NF-kappaB dependent luciferase using PMA/Ionomycin as an inducer - 2
2793 confirmatory 3 / 0 / 13 SAR analysis of NF-kappaB dependent luciferase using DAP as an inducer - Set 2
More...

Gene RIF (177)

PMID Text
27007849 NOD1 and NOD2, two members of the NOD-like receptor family of pattern recognition receptors, are important mediators of ER-stress-induced inflammation in mouse and human cells
26880761 contributes to fetal growth retardation and death through vascular inflammation
26759244 findings illuminated a role for NOD1 signaling in attenuating H. pylori-induced Cdx2 expression in gastric epithelial cells
26238283 NOD1/CARD4 gene may influence the diagnosis and treatment of lung cancer
26052894 Activation of the innate immune pathway via NOD1 may be partially responsible for the increased systemic inflammation and insulin resistance in metabolic syndrome.
25933107 NOD1 rs2709800, NOD2 rs718226, rs2111235, rs7205423 and interaction between rs718226 and H. pylori infection may be related to risk of gastric lesions.
25854006 A significant association of the NOD1 +32656 GG insertion variant with protection against infection with Chlamydia trachomatis has been detected [p: 0.0057; OR: 0.52].
25840495 The higher NOD1 and NOD2 were observed in villi from patients who experienced recurrent spontaneous abortion compared with those who experienced a normal pregnancy.
25801093 NOD1 signaling results in the induction of the cellular degradation pathway of autophagy and the development of pro-inflammatory responses that activate the adaptive immune system.
25503380 We found that RNA interference-induced Caspase-12 silencing increased NOD1, hBD1 and hBD2 expression
More...

AA Sequence

MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRK      1 - 70
ILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVVVNTDPVSRYTQQLRHHLGRD     71 - 140
SKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSLACLLDHTTGILNEQGETIFILGDAGVGKSM    141 - 210
LLQRLQSLWATGRLDAGVKFFFHFRCRMFSCFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVAL    211 - 280
FTFDGLDELHSDLDLSRVPDSSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLR    281 - 350
GFSPSHLRAYARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT    351 - 420
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQEEVQASGLQE    421 - 490
RDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQELLRFFQEWMPPAGAATTSCYP    491 - 560
PFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAKQKLLRHLVPAAALRRKRKALWAHLFSSLRG    561 - 630
YLKSLPRVQVESFNQVQAMPTFIWMLRCIYETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLH    631 - 700
HFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITD    701 - 770
VGARYVTKILDECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP    771 - 840
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKHLWLIQNQITA    841 - 910
KGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF                               911 - 953
//

Text Mined References (183)

PMID Year Title
27007849 2016 NOD1 and NOD2 signalling links ER stress with inflammation.
26880761 2016 Activation of Nod1 Signaling Induces Fetal Growth Restriction and Death through Fetal and Maternal Vasculopathy.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26759244 2016 Cdx2 Expression and Intestinal Metaplasia Induced by H. pylori Infection of Gastric Cells Is Regulated by NOD1-Mediated Innate Immune Responses.
26238283 2015 The role of NOD1/CARD4 and NOD2/CARD15 genetic variations in lung cancer risk.
26052894 2015 Increased NOD1, but not NOD2, activity in subcutaneous adipose tissue from patients with metabolic syndrome.
25933107 2015 NOD1 and NOD2 Genetic Variants in Association with Risk of Gastric Cancer and Its Precursors in a Chinese Population.
25854006 2015 NOD1 in contrast to NOD2 functional polymorphism influence Chlamydia trachomatis infection and the risk of tubal factor infertility.
25840495 2015 NOD1 and NOD2 control the invasiveness of trophoblast cells via the MAPK/p38 signaling pathway in human first-trimester pregnancy.
25801093 2015 The intracellular location, mechanisms and outcomes of NOD1 signaling.
More...