Property Summary

NCBI Gene PubMed Count 21
PubMed Score 40.31
PubTator Score 41.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 0.000
medulloblastoma, large-cell 1.300 0.000
breast carcinoma -1.200 0.000
adult high grade glioma 1.200 0.001
lung carcinoma -1.200 0.000
pituitary cancer -1.800 0.000
chronic rhinosinusitis -1.253 0.042

Gene RIF (17)

PMID Text
25746324 DLEC1 is down-regulated in head and neck squamous cell tumors and it's promoter methylation is not associated with the clinicopathological parameters.
25648635 DLEC1 mediates tumor-suppressive activities through NF-kappaB signaling.
25574068 DLEC1 methylation was not associated with the clinicopathological variables of gastric cancer.
23050586 methylation-mediated silencing of DLEC1 plays an important role in multiple lymphomagenesis, and may serve as a non-invasive tumor marker for lymphoma diagnosis
22569009 Repression of DLEC1 in squamous cell carcinoma tissues is associated with promoter hypermethylation. DLEC1 is downregulated in sinonasal squamous cell carcinoma and inverted papilloma and has a distinct mechanism.
21443130 Epigenetic inactivation of DLEC1 was crucial in gastric and colorectal carcinogenesis. DLEC1 methylation in serum may be a promise biomarker for GAC and CRAC early diagnosis.
20952247 results demonstrate that down-expression and promoter methylation of DLEC1 increased from normal tissues to premalignancies and then to malignancies.
20639048 DLEC1 is often down-regulated by CpG methylation and shows tumor inhibitory function in renal cell carcinoma cells, indicating its role as a tumor suppressor
20630829 Frequent epigenetic inactivation of deleted in lung and esophageal cancer 1 gene by promoter methylation is associated with non-small-cell lung cancer.
20530412 DLEC1 expression levels were significantly lower in samples from patients who developed metastasis, local recurrence, or died of breast cancer when compared to those who were disease free for >10 years.
More...

AA Sequence

METRSSKTRRSLASRTNECQGTMWAPTSPPAGSSSPSQPTWKSSLYSSLAYSEAFHYSFAARPRRLTQLA      1 - 70
LAQRPEPQLLRLRPSSLRTQDISHLLTGVFRNLYSAEVIGDEVSASLIKARGSENERHEEFVDQLQQIRE     71 - 140
LYKQRLDEFEMLERHITQAQARAIAENERVMSQAGVQDLESLVRLPPVKSVSRWCIDSELLRKHHLISPE    141 - 210
DYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTP    211 - 280
KAKERTREPLKKASQPRNKNWMNHLRVPQRELDRLLLARMESRNHFLKNPRFFPPNTRYGGKSLVFPPKK    281 - 350
PAPIGEFQSTEPEQSCADTPVFLAKPPIGFFTDYEIGPVYEMVIALQNTTTTSRYLRVLPPSTPYFALGL    351 - 420
GMFPGKGGMVAPGMTCQYIVQFFPDCLGDFDDFILVETQSAHTLLIPLQARRPPPVLTLSPVLDCGYCLI    421 - 490
GGVKMTRFICKNVGFSVGRFCIMPKTSWPPLSFKAIATVGFVEQPPFGILPSVFELAPGHAILVEVLFSP    491 - 560
KSLGKAEQTFIIMCDNCQIKELVTIGIGQLIALDLIYISGEKSQPDPGELTDLTAQHFIRFEPENLRSTA    561 - 630
RKQLIIRNATHVELAFYWQIMKPNLQPLMPGETFSMDSIKCYPDKETAFSIMPRKGVLSPHTDHEFILSF    631 - 700
SPHELRDFHSVLQMVLEEVPEPVSSEAESLGHSSYSVDDVIVLEIEVKGSVEPFQVLLEPYALIIPGENY    701 - 770
IGINVKKAFKMWNNSKSPIRYLWGKISDCHIIEVEPGTGVIEPSEVGDFELNFTGGVPGPTSQDLLCEIE    771 - 840
DSPSPVVLHIEAVFKGPALIINVSALQFGLLRLGQKATNSIQIRNVSQLPATWRMKESPVSLQERPEDVS    841 - 910
PFDIEPSSGQLHSLGECRVDITLEALHCQHLETVLELEVENGAWSYLPVYAEVQKPHVYLQSSQVEVRNL    911 - 980
YLGVPTKTTITLINGTLLPTQFHWGKLLGHQAEFCMVTVSPKHGLLGPSEECQLKLELTAHTQEELTHLA    981 - 1050
LPCHVSGMKKPLVLGISGKPQGLQVAITISKESSDCSTEQWPGHPKELRLDFGSAVPLRTRVTRQLILTN   1051 - 1120
RSPIRTRFSLKFEYFGSPQNSLSKKTSLPNMPPALLKTVRMQEHLAKREQLDFMESMLSHGKGAAFFPHF   1121 - 1190
SQGMLGPYQQLCIDITGCANMWGEYWDNLICTVGDLLPEVIPVHMAAVGCPISSLRTTSYTIDQAQKEPA   1191 - 1260
MRFGTQVSGGDTVTRTLRLNNSSPCDIRLDWETYVPEDKEDRLVELLVFYGPPFPLRDQAGNELVCPDTP   1261 - 1330
EGGCLLWSPGPSSSSEFSHETDSSVEGSSSASNRVAQKLISVILQAHEGVPSGHLYCISPKQVVVPAGGS   1331 - 1400
STIYISFTPMVLSPEILHKVECTGYALGFMSLDSKVEREIPGKRHRLQDFAVGPLKLDLHSYVRPAQLSV   1401 - 1470
ELDYGGSMEFQCQASDLIPEQPCSGVLSELVTTHHLKLTNTTEIPHYFRLMVSRPFSVSQDGASQDHRAP   1471 - 1540
GPGQKQECEEETASADKQLVLQAQENMLVNVSFSLSLELLSYQKLPADQTLPGVDIQQSASGEREMVFTQ   1541 - 1610
NLLLEYTNQTTQVVPLRAVVAVPELQLSTSWVDFGTCFVSQQRVREVYLMNLSGCRSYWTMLMGQQEPAK   1611 - 1680
AAVAFRVSPNSGLLEARSANAPPTSIALQVFFTARSSELYESTMVVEGVLGEKSCTLRLRGQGSYDERYM   1681 - 1750
LPHQP                                                                    1751 - 1755
//

Text Mined References (24)

PMID Year Title
25746324 2015 DLEC1 is not silenced solely by promoter methylation in head and neck squamous cell carcinoma.
25648635 2015 DLEC1, a 3p tumor suppressor, represses NF-?B signaling and is methylated in prostate cancer.
25574068 2014 Methylation of DLEC1 promoter is a predictor for recurrence in Chinese patients with gastric cancer.
23050586 2012 Epigenetic silencing of the 3p22 tumor suppressor DLEC1 by promoter CpG methylation in non-Hodgkin and Hodgkin lymphomas.
22569009 2012 Downregulation of DLEC1 in sinonasal inverted papilloma and squamous cell carcinoma.
21443130 Epigenetic inactivation of deleted in lung and esophageal cancer 1 gene by promoter methylation in gastric and colorectal adenocarcinoma.
20952247 2010 Transcriptional repression of DLEC1 associates with the depth of tumor invasion in oral squamous cell carcinoma.
20639048 2010 Aberrant promoter methylation of DLEC1, a critical 3p22 tumor suppressor for renal cell carcinoma, is associated with more advanced tumor stage.
20630829 2010 Frequent epigenetic inactivation of deleted in lung and esophageal cancer 1 gene by promoter methylation in non-small-cell lung cancer.
20530412 2010 Evidence of a tumour suppressor function for DLEC1 in human breast cancer.
More...