Property Summary

NCBI Gene PubMed Count 20
PubMed Score 53.33
PubTator Score 43.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.600 3.9e-02
cystic fibrosis -1.100 1.5e-03
dermatomyositis 1.600 1.3e-04
group 3 medulloblastoma 1.200 1.4e-03
malignant mesothelioma 1.100 1.2e-05
osteosarcoma 1.054 2.3e-02
subependymal giant cell astrocytoma 1.156 1.0e-02
Waldenstrons macroglobulinemia 1.107 2.8e-03

 GO Process (1)

Gene RIF (7)

AA Sequence

MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQ      1 - 70
YSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK              71 - 131
//

Text Mined References (24)

PMID Year Title