Property Summary

NCBI Gene PubMed Count 20
Grant Count 36
R01 Count 15
Funding $16,559,078.65
PubMed Score 47.08
PubTator Score 43.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.107 0.003
malignant mesothelioma 1.100 0.000
osteosarcoma 1.054 0.023
cystic fibrosis -1.100 0.002
group 3 medulloblastoma 1.200 0.001
subependymal giant cell astrocytoma 1.251 0.011
acute myeloid leukemia -1.600 0.039
dermatomyositis 1.600 0.000

 GO Process (1)

Gene RIF (7)

PMID Text
25940090 Ca(2+)/Calmodulin binding to the N-terminal of Par17 causes steric hindrance of the Par17 active site, thus interfering with the Par17/tubulin interaction.
25645591 Par14 can be described as an endogenous non-histone chromatin protein, which binds DNA in vivo
25595659 Data indicate that Pin1 prolyl isomerase active site cysteine, Cys113, is highly susceptible to oxidation.
23720771 Data indicate the association of Par14 with insulin receptor substrate 1 (IRS-1) in human HepG2 cells overexpressing both as well as endogenously in the mouse liver.
16522211 Identification of a longer Parvulin isoform (Par17) that has an extension at the 5' end including a 75 bp extended open reading frame.
12860119 subcellular localization and DNA binding properties of hPar14 are regulated by phosphorylation of the N-terminal domain
12144781 The N-terminal basic domain of human parvulin hPar14 is responsible for the entry to the nucleus and high-affinity DNA-binding.

AA Sequence

MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQ      1 - 70
YSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK              71 - 131
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940090 2015 Parvulin 17-catalyzed Tubulin Polymerization Is Regulated by Calmodulin in a Calcium-dependent Manner.
25645591 2015 Human DNA-binding peptidyl-prolyl cis/trans isomerase Par14 is cell cycle dependently expressed and associates with chromatin in vivo.
25595659 2015 Peroxide-mediated oxidation and inhibition of the peptidyl-prolyl isomerase Pin1.
25416956 2014 A proteome-scale map of the human interactome network.
23720771 2013 Par14 protein associates with insulin receptor substrate 1 (IRS-1), thereby enhancing insulin-induced IRS-1 phosphorylation and metabolic actions.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
19369196 2009 Parvulin (Par14), a peptidyl-prolyl cis-trans isomerase, is a novel rRNA processing factor that evolved in the metazoan lineage.
More...