Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.00
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
astrocytoma 1146 3.6e-10
ependymoma 4679 8.1e-08
osteosarcoma 7950 3.7e-04
glioblastoma 5792 9.7e-04
axial spondyloarthropathy 28 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 62 3 6.138 3.1
Nijmegen breakage syndrome 24 3.023 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.200 3.6e-10
axial spondyloarthropathy 1.300 1.3e-02
ependymoma 1.700 8.1e-08
glioblastoma 1.100 9.7e-04
osteosarcoma 1.396 3.7e-04

Synonym

Accession Q9Y236
Symbols hT41
C8orf1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDL      1 - 70
EYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEGSMLT     71 - 140
ISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQDD    141 - 210
DDIQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPF    211 - 280
VFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLY    281 - 350
PEYHKVYHMMCTQSYSVDSNLLSDYTSFPEHRVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLS    351 - 420
FLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQK    421 - 490
KKHLFVERGGGDGIA                                                           491 - 505
//

Text Mined References (6)

PMID Year Title