Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.05
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.200 0.000
osteosarcoma 1.396 0.000
posterior fossa group A ependymoma 1.900 0.000
glioblastoma 1.100 0.001
axial spondyloarthropathy 1.300 0.013

AA Sequence

MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDL      1 - 70
EYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHVVLGKGPPGGAWHNMEGSMLT     71 - 140
ISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTYITSVSRLYRDQDD    141 - 210
DDIQDRDISTKHLQIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPF    211 - 280
VFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLY    281 - 350
PEYHKVYHMMCTQSYSVDSNLLSDYTSFPEHRVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLS    351 - 420
FLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQK    421 - 490
KKHLFVERGGGDGIA                                                           491 - 505
//

Text Mined References (6)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9933573 1999 Sequence analysis of an 800-kb genomic DNA region on chromosome 8q21 that contains the Nijmegen breakage syndrome gene, NBS1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.