Property Summary

NCBI Gene PubMed Count 15
Grant Count 25
R01 Count 19
Funding $1,336,519.5
PubMed Score 16.53
PubTator Score 12.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.003
gastric carcinoma -2.100 0.035
psoriasis -1.200 0.000

Gene RIF (5)

PMID Text
21469143 Findings indicate that aberrant APOBEC2 expression causes nucleotide alterations in the transcripts of the specific target gene and could be involved in the development of human hepatocellular carcinoma through hepatic inflammation.
20138841 The APOBEC2 was confirmed to be elevated in the tonsils with IgAN patients, and the gene expression level was negatively related with serum IgG level in overall patients.
19911124 Studies indicate the APOBEC family consists of 11 members: APOBEC-1 (Apo1), APOBEC-2 (Apo2), activation induced cytidine deaminase (AID), APOBEC- 3A, -3B, -3C, -3DE, -3F, -3H (Apo3A-H) and APOBEC- 4 (Apo4).
18974842 Observational study of gene-disease association. (HuGE Navigator)
17187054 crystal structure of APOBEC2

AA Sequence

MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFL      1 - 70
CYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLS     71 - 140
KTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQE    141 - 210
NFLYYEEKLADILK                                                            211 - 224
//

Text Mined References (16)

PMID Year Title
21496894 2011 Hydroxylation of 5-methylcytosine by TET1 promotes active DNA demethylation in the adult brain.
21469143 2012 Excessive activity of apolipoprotein B mRNA editing enzyme catalytic polypeptide 2 (APOBEC2) contributes to liver and lung tumorigenesis.
20138841 2010 Microarray analysis of tonsils in immunoglobulin A nephropathy patients.
19911124 2009 APOBEC deaminases-mutases with defensive roles for immunity.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
17187054 2007 The APOBEC-2 crystal structure and functional implications for the deaminase AID.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12683974 2003 Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business.
More...