Property Summary

NCBI Gene PubMed Count 15
PubMed Score 19.03
PubTator Score 12.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.9e-19
medulloblastoma, large-cell 6241 3.1e-03
gastric carcinoma 807 3.5e-02

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma -2.100 3.5e-02
medulloblastoma, large-cell 1.100 3.1e-03
psoriasis -1.200 3.9e-19

Gene RIF (5)

AA Sequence

MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFL      1 - 70
CYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLS     71 - 140
KTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQE    141 - 210
NFLYYEEKLADILK                                                            211 - 224
//

Text Mined References (16)

PMID Year Title