Property Summary

Ligand Count 2,699
NCBI Gene PubMed Count 42
PubMed Score 268.12
PubTator Score 92.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.800 1.3e-03
astrocytic glioma -1.500 2.0e-02
Astrocytoma, Pilocytic -1.400 7.1e-05
atypical teratoid / rhabdoid tumor -2.000 7.9e-03
Breast cancer 1.200 2.8e-03
cutaneous lupus erythematosus 1.200 4.5e-02
ependymoma -1.300 3.4e-03
group 4 medulloblastoma -1.500 5.4e-03
invasive ductal carcinoma -1.200 1.7e-02
lung carcinoma 1.600 4.5e-10
malignant mesothelioma 3.500 1.4e-08
medulloblastoma, large-cell -3.800 5.8e-09
oligodendroglioma -1.600 1.6e-02
ovarian cancer -2.700 2.7e-08
Pick disease -1.100 5.5e-04
primary Sjogren syndrome 1.100 7.9e-03
subependymal giant cell astrocytoma -2.273 3.5e-02

Synonym

Accession Q9Y233 Q6FHX1 Q9HCP9 Q9NTV4 Q9ULW9 Q9Y5T1
Symbols ADSD2
IOLOD
HSPDE10A
PDE10A19
LINC00473

Gene

PDB

1LRB   2OUN   2OUP   2OUQ   2OUR   2OUS   2OUU   2OUV   2OUY   2WEY   2Y0J   2ZMF   3SN7   3SNI   3SNL   3UI7   3UUO   3WI2   3WS8   3WS9   3WYK   3WYL   3WYM   4AEL   4AJD   4AJF   4AJG   4AJM   4BBX   4DDL   4DFF   4FCB   4FCD   4HEU   4HF4   4LKQ   4LLJ   4LLK   4LLP   4LLX   4LM0   4LM1   4LM2   4LM3   4LM4   4MRW   4MRZ   4MS0   4MSA   4MSC   4MSE   4MSH   4MSN   4MUW   4MVH   4P0N   4P1R   4PHW   4TPM   4TPP   4WN1   4XY2   4YQH   4YS7   4ZO5   5AXP   5AXQ   5B4K   5B4L   5C1W   5C28   5C29   5C2A   5C2E   5C2H   5DH4   5DH5   5EDE   5EDG   5EDH   5EDI   5I2R   5K9R   5UWF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (26)

AA Sequence

MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTN      1 - 70
MQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLI     71 - 140
PAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHW    141 - 210
GKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKN    211 - 280
LVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP    281 - 350
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR    351 - 420
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGT    421 - 490
SCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGF    491 - 560
SNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFG    561 - 630
NRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQP    631 - 700
IPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV    701 - 770
AQKAAASED                                                                 771 - 779
//

Text Mined References (46)

PMID Year Title