Property Summary

Ligand Count 2,702
NCBI Gene PubMed Count 42
PubMed Score 268.12
PubTator Score 92.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.800 1.3e-03
astrocytic glioma -1.500 2.0e-02
Astrocytoma, Pilocytic -1.400 7.1e-05
atypical teratoid / rhabdoid tumor -2.000 7.9e-03
Breast cancer 1.200 2.8e-03
cutaneous lupus erythematosus 1.200 4.5e-02
ependymoma -1.300 3.4e-03
group 4 medulloblastoma -1.500 5.4e-03
invasive ductal carcinoma -1.200 1.7e-02
lung carcinoma 1.600 4.5e-10
malignant mesothelioma 3.500 1.4e-08
medulloblastoma, large-cell -3.800 5.8e-09
oligodendroglioma -1.600 1.6e-02
ovarian cancer -2.700 2.7e-08
Pick disease -1.100 5.5e-04
primary Sjogren syndrome 1.100 7.9e-03
subependymal giant cell astrocytoma -2.273 3.5e-02

PDB (84)

Gene RIF (26)

AA Sequence

MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTN      1 - 70
MQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLI     71 - 140
PAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHW    141 - 210
GKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKN    211 - 280
LVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP    281 - 350
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR    351 - 420
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGT    421 - 490
SCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGF    491 - 560
SNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFG    561 - 630
NRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQP    631 - 700
IPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV    701 - 770
AQKAAASED                                                                 771 - 779
//

Text Mined References (46)

PMID Year Title