Property Summary

NCBI Gene PubMed Count 39
Grant Count 34
R01 Count 3
Funding $5,932,661.62
PubMed Score 240.54
PubTator Score 92.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q9Y233 Q6FHX1 Q9HCP9 Q9NTV4 Q9ULW9 Q9Y5T1
Symbols ADSD2
IOLOD
HSPDE10A
PDE10A19
LINC00473

Gene

PANTHER Protein Class (2)

PDB

1LRB   2OUN   2OUP   2OUQ   2OUR   2OUS   2OUU   2OUV   2OUY   2WEY   2Y0J   2ZMF   3SN7   3SNI   3SNL   3UI7   3UUO   3WI2   3WS8   3WS9   3WYK   3WYL   3WYM   4AEL   4AJD   4AJF   4AJG   4AJM   4BBX   4DDL   4DFF   4FCB   4FCD   4HEU   4HF4   4LKQ   4LLJ   4LLK   4LLP   4LLX   4LM0   4LM1   4LM2   4LM3   4LM4   4MRW   4MRZ   4MS0   4MSA   4MSC   4MSE   4MSH   4MSN   4MUW   4MVH   4P0N   4P1R   4PHW   4TPM   4TPP   4WN1   4XY2   4YQH   4YS7   4ZO5   5AXP   5AXQ   5B4K   5B4L   5C1W   5C28   5C29   5C2A   5C2E   5C2H   5DH4   5DH5   5EDE   5EDG   5EDH   5EDI   5I2R   5K9R  

Gene RIF (23)

PMID Text
27058447 We have demonstrated that de novo dominant mutations in PDE10A are the cause of a unique movement disorder characterized by benign childhood-onset chorea and typical MRI abnormalities of the striatum.
27058446 germline PDE10A mutations associated with hyperkinetic movement disorder
26905414 The PDE10A gene is currently known to be comprised of 23 exons26 and maps to chromosome 6q26,17, 18 a region previously associated with bipolar disorder.
26802091 Longitudinal data in a cohort of patients with early Huntington disease found PDE10 to be a useful biomarker of disease progression.
26299804 cGMP PDE isozymes, PDE5 and 10, are elevated in colon tumor cells compared with normal colonocytes, and inhibitors and siRNAs can selectively suppress colon tumor cell growth
25941078 Lu AF33241 represents a novel PDE2A/PDE10A inhibitor tool which can penetrate the blood brain barrier.
24704829 Data provide evidence that PDE10 is involved in colon tumorigenesis and show its overexpression in colon tumor cells compared with colonocytes.
24353339 PDE10A activity in medium spiny neurons in Huntington's disease might still be high in critical subcellular compartments, despite the overall striatal PDE10A decrease measured using positron-emission tomography.
23691025 HPRT-deficiency alters cAMP/PKA signaling pathway, which is in part due to the increased of PDE10A expression and activi
21494592 The present study is the first to demonstrate a central role of PDE10A in progressive pulmonary vascular remodeling.
More...

AA Sequence

MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTN      1 - 70
MQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLI     71 - 140
PAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHW    141 - 210
GKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKN    211 - 280
LVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP    281 - 350
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR    351 - 420
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGT    421 - 490
SCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGF    491 - 560
SNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFG    561 - 630
NRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQP    631 - 700
IPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV    701 - 770
AQKAAASED                                                                 771 - 779
//

Text Mined References (43)

PMID Year Title
27058447 2016 De Novo Mutations in PDE10A Cause Childhood-Onset Chorea with Bilateral Striatal Lesions.
27058446 2016 Biallelic Mutations in PDE10A Lead to Loss of Striatal PDE10A and a Hyperkinetic Movement Disorder with Onset in Infancy.
26905414 2016 Novel, primate-specific PDE10A isoform highlights gene expression complexity in human striatum with implications on the molecular pathology of bipolar disorder.
26802091 2016 Change in PDE10 across early Huntington disease assessed by [18F]MNI-659 and PET imaging.
26299804 2015 Suppression of ?-catenin/TCF transcriptional activity and colon tumor cell growth by dual inhibition of PDE5 and 10.
25941078 2015 Characterisation of Lu AF33241: A novel, brain-penetrant, dual inhibitor of phosphodiesterase (PDE) 2A and PDE10A.
24951543 2014 Meta-analysis of genome-wide association studies in multiethnic Asians identifies two loci for age-related nuclear cataract.
24704829 2015 Phosphodiesterase 10A: a novel target for selective inhibition of colon tumor cell growth and ?-catenin-dependent TCF transcriptional activity.
24353339 2014 PET imaging shows loss of striatal PDE10A in patients with Huntington disease.
23691025 2013 HPRT-deficiency dysregulates cAMP-PKA signaling and phosphodiesterase 10A expression: mechanistic insight and potential target for Lesch-Nyhan Disease?
More...