Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.86
PubTator Score 9.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Small Cell Lung Carcinoma 41 0.0 0.0
Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 2.2
Disease Target Count Z-score Confidence
Gingival recession 13 3.724 1.9
Azoospermia 110 3.205 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.400 9.1e-10
lung cancer 1.200 3.0e-03
malignant mesothelioma 1.100 3.5e-06
pediatric high grade glioma 1.100 7.5e-05
psoriasis -1.400 2.5e-04
sonic hedgehog group medulloblastoma 1.100 1.9e-03
spina bifida -1.390 4.3e-02

Gene RIF (7)

AA Sequence

MTFQASHRSAWGKSRKKNWQYEGPTQKLFLKRNNVSAPDGPSDPSISVSSEQSGAQQPPALQVERIVDKR      1 - 70
KNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRS     71 - 140
TNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNMDLAKSGIKILVPKSPVKSRTAVD    141 - 210
GFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRIHPLVPQVPGPVTAAMATGLA    211 - 280
VNGKGTSPFMDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQD    281 - 350
GFTHILLSTKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRES    351 - 420
TKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMF    421 - 490
PKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMK    491 - 560
MELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF                                    561 - 598
//

Text Mined References (31)

PMID Year Title