Property Summary

NCBI Gene PubMed Count 16
Grant Count 14
R01 Count 14
Funding $945,795.91
PubMed Score 13.99
PubTator Score 9.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.400 0.000
ependymoma 1.400 0.000
lung cancer 1.200 0.003
pediatric high grade glioma 1.100 0.000
sonic hedgehog group medulloblastoma 1.100 0.002
spina bifida -1.390 0.043

Gene RIF (6)

PMID Text
24671995 The epigenetic regulators CDYL and EZH2 to dendrite morphogenesis and might shed new light on our understanding of the regulation of the neurodevelopment.
23629948 These findings suggest that h-CDYLb and G9a are cooperatively involved in hepatocellular carcinomas
22009739 CDYL functions as a molecular bridge between PRC2 and the repressive chromatin mark H3K27me3, forming a positive feedback loop to facilitate the establishment and propagation of H3K27me3 modifications along the chromatin
19808672 Results imply that multimeric binding to H3K9me3 by CDYL1b homomeric complexes is essential for efficient chromatin targeting.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19061646 Chromodomain on Y-like (CDYL) is identified as a REST corepressor that physically bridges REST and the histone methylase G9a to repress transcription.

AA Sequence

MTFQASHRSAWGKSRKKNWQYEGPTQKLFLKRNNVSAPDGPSDPSISVSSEQSGAQQPPALQVERIVDKR      1 - 70
KNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRS     71 - 140
TNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPSLSSRKNMDLAKSGIKILVPKSPVKSRTAVD    141 - 210
GFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRIHPLVPQVPGPVTAAMATGLA    211 - 280
VNGKGTSPFMDALTANGTTNIQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQD    281 - 350
GFTHILLSTKSSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRES    351 - 420
TKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMF    421 - 490
PKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMK    491 - 560
MELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF                                    561 - 598
//

Text Mined References (29)

PMID Year Title
24671995 2014 Coordinated regulation of dendrite arborization by epigenetic factors CDYL and EZH2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23629948 2013 Short-Form CDYLb but not long-form CDYLa functions cooperatively with histone methyltransferase G9a in hepatocellular carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22009739 2011 Corepressor protein CDYL functions as a molecular bridge between polycomb repressor complex 2 and repressive chromatin mark trimethylated histone lysine 27.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19808672 2009 Multimerization and H3K9me3 binding are required for CDYL1b heterochromatin association.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
More...