Property Summary

NCBI Gene PubMed Count 22
PubMed Score 31.08
PubTator Score 26.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.400 1.4e-06
astrocytoma -1.100 1.6e-04
Astrocytoma, Pilocytic -2.200 1.5e-07
atypical teratoid / rhabdoid tumor -3.800 5.4e-03
ependymoma -2.600 1.0e-05
gastric carcinoma -1.500 2.2e-02
glioblastoma -2.700 8.5e-06
group 3 medulloblastoma -1.600 2.6e-02
interstitial cystitis -3.500 2.5e-04
medulloblastoma, large-cell -1.200 3.5e-04
non primary Sjogren syndrome sicca -1.100 2.4e-02
pituitary cancer 4.100 2.4e-07
primitive neuroectodermal tumor -2.300 4.5e-02
psoriasis -1.600 3.7e-14
subependymal giant cell astrocytoma -4.269 3.1e-02

Gene RIF (8)

AA Sequence

MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWV      1 - 70
WPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPT     71 - 140
HTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELS    141 - 210
KSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENY    211 - 280
IPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSV    281 - 350
GNLEKWFWN                                                                 351 - 359
//

Text Mined References (22)

PMID Year Title