Property Summary

NCBI Gene PubMed Count 22
Grant Count 1
Funding $119,737.5
PubMed Score 29.23
PubTator Score 26.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -2.000 0.012
glioblastoma -3.700 0.001
ependymoma -2.600 0.000
group 4 medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.800 0.005
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.300 0.045
interstitial cystitis -4.000 0.000
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -2.200 0.000
non primary Sjogren syndrome sicca -1.100 0.024
subependymal giant cell astrocytoma -4.269 0.031
gastric carcinoma -1.500 0.022
pituitary cancer 4.100 0.000
psoriasis -1.600 0.000

Synonym

Accession Q9Y231 Q5T0W4
Symbols Fuc-TIX

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (8)

PMID Text
23263199 N-glycosylation of human alpha1,3-fucosyltransferase IX is required for enzyme stability and activity.
23192350 FUT9 plays a significant role during human, but not mouse, E-selectin-mediated cell adhesion.
23000574 Downregulation of fucosyltransferase 9 leads to decreased Lewis(x) levels and impaired neurite outgrowth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460885 A single nucleotide polymorphism in FUT9, rs3811070, was significantly associated with placental malaria infection.
18395013 FUT9 was found to be a trans-Golgi and trans-Golgi network (TGN) glycosyltransferase from confocal immunofluorescence co-localization with the markers of the secretory pathway beta4-galactosyltransferase (trans-Golgi and TGN) and TGN-46 (TGN)
16282604 FUTIX plays a key role in the synthesis of Lex groups of CEACAM1
12107078 Fuc-TIX: a versatile alpha1,3-fucosyltransferase with a distinct acceptor- and site-specificity profile

AA Sequence

MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWV      1 - 70
WPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPT     71 - 140
HTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELS    141 - 210
KSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENY    211 - 280
IPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSV    281 - 350
GNLEKWFWN                                                                 351 - 359
//

Text Mined References (22)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23263199 2013 N-glycosylations of human ?1,3-fucosyltransferase IX are required for full enzyme activity.
23192350 2013 Silencing ?1,3-fucosyltransferases in human leukocytes reveals a role for FUT9 enzyme during E-selectin-mediated cell adhesion.
23000574 2012 Expression of glycogenes in differentiating human NT2N neurons. Downregulation of fucosyltransferase 9 leads to decreased Lewis(x) levels and impaired neurite outgrowth.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19460885 2009 A variant in the gene FUT9 is associated with susceptibility to placental malaria infection.
18395013 2008 Human fucosyltransferase IX: specificity towards N-linked glycoproteins and relevance of the cytoplasmic domain in intra-Golgi localization.
16282604 2006 CEACAM1, an adhesion molecule of human granulocytes, is fucosylated by fucosyltransferase IX and interacts with DC-SIGN of dendritic cells via Lewis x residues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...