Property Summary

NCBI Gene PubMed Count 22
PubMed Score 29.23
PubTator Score 26.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.66189676717876E-14
pilocytic astrocytoma 3086 1.73331616510522E-7
medulloblastoma, large-cell 6234 2.22069759701077E-7
pituitary cancer 1972 2.43838775179579E-7
interstitial cystitis 2299 3.74928640396233E-6
ependymoma 2514 1.00035515900638E-5
pediatric high grade glioma 2712 1.70437659169197E-5
group 4 medulloblastoma 1875 1.67881781517534E-4
glioblastoma 5572 0.00140003264170735
atypical teratoid / rhabdoid tumor 4369 0.00535570520369831
astrocytoma 1493 0.012304056478209
gastric carcinoma 832 0.0224763476271839
non primary Sjogren syndrome sicca 840 0.0237590032658626
subependymal giant cell astrocytoma 2287 0.0311731915566597
primitive neuroectodermal tumor 3031 0.0446129635987737

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -2.000 0.012
glioblastoma -3.700 0.001
ependymoma -2.600 0.000
group 4 medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.800 0.005
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.300 0.045
interstitial cystitis -4.000 0.000
pediatric high grade glioma -3.200 0.000
pilocytic astrocytoma -2.200 0.000
non primary Sjogren syndrome sicca -1.100 0.024
subependymal giant cell astrocytoma -4.269 0.031
gastric carcinoma -1.500 0.022
pituitary cancer 4.100 0.000
psoriasis -1.600 0.000

Synonym

Accession Q9Y231 Q5T0W4
Symbols Fuc-TIX

Gene

PANTHER Protein Class (2)

  Ortholog (13)

 GWAS Trait (1)

Gene RIF (8)

PMID Text
23263199 N-glycosylation of human alpha1,3-fucosyltransferase IX is required for enzyme stability and activity.
23192350 FUT9 plays a significant role during human, but not mouse, E-selectin-mediated cell adhesion.
23000574 Downregulation of fucosyltransferase 9 leads to decreased Lewis(x) levels and impaired neurite outgrowth.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460885 A single nucleotide polymorphism in FUT9, rs3811070, was significantly associated with placental malaria infection.
18395013 FUT9 was found to be a trans-Golgi and trans-Golgi network (TGN) glycosyltransferase from confocal immunofluorescence co-localization with the markers of the secretory pathway beta4-galactosyltransferase (trans-Golgi and TGN) and TGN-46 (TGN)
16282604 FUTIX plays a key role in the synthesis of Lex groups of CEACAM1
12107078 Fuc-TIX: a versatile alpha1,3-fucosyltransferase with a distinct acceptor- and site-specificity profile

AA Sequence

MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWV      1 - 70
WPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPT     71 - 140
HTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELS    141 - 210
KSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENY    211 - 280
IPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSV    281 - 350
GNLEKWFWN                                                                 351 - 359
//

Text Mined References (22)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23263199 2013 N-glycosylations of human ?1,3-fucosyltransferase IX are required for full enzyme activity.
23192350 2013 Silencing ?1,3-fucosyltransferases in human leukocytes reveals a role for FUT9 enzyme during E-selectin-mediated cell adhesion.
23000574 2012 Expression of glycogenes in differentiating human NT2N neurons. Downregulation of fucosyltransferase 9 leads to decreased Lewis(x) levels and impaired neurite outgrowth.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19460885 2009 A variant in the gene FUT9 is associated with susceptibility to placental malaria infection.
18395013 2008 Human fucosyltransferase IX: specificity towards N-linked glycoproteins and relevance of the cytoplasmic domain in intra-Golgi localization.
16282604 2006 CEACAM1, an adhesion molecule of human granulocytes, is fucosylated by fucosyltransferase IX and interacts with DC-SIGN of dendritic cells via Lewis x residues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...