Property Summary

NCBI Gene PubMed Count 87
Grant Count 31
R01 Count 25
Funding $2,025,626.06
PubMed Score 83.81
PubTator Score 76.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.085 0.002
osteosarcoma -1.199 0.001
lung cancer 2.000 0.000
colon cancer 1.600 0.000
diabetes mellitus -1.500 0.001
non primary Sjogren syndrome sicca 1.100 0.045
ovarian cancer 2.300 0.000

Gene RIF (48)

PMID Text
26863765 by means of molecular docking approaches we first modeled the structures of hetero-hexameric TIP49 ( TIP49a and TIP49b )complexes with short ds-DNA fragments (20 base pairs with different GC content) within the central channel of hexameric ring
26303906 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26211835 The authors report that HIV-1 exploits the host factor RuvB-like 2 (RVB2) to balance relative expression of Gag and Env for efficient production of infectious virions.
26211835 HIV-1 Env antagonizes RUVBL2 by competitive interaction with HIV-1 MA
26211835 HIV-1 Env antagonizes RUVBL2 by competitive interaction with HIV-1 MA
26211835 HIV-1 Env antagonizes RUVBL2 by competitive interaction with HIV-1 MA
26211835 shRNA downregulation of RUVBL2 reduces the the infectivity of HIV-1 produced by HEK293T cells; RUVBL2 enhances HIV-1 infectivity
25957047 results reveal a novel mechanism for the control of NF-kappaB pathway by cytoplasmic Reptin
25875766 Data suggest that overexpression of Reptin in hepatocellular carcinoma (HCC) could be a factor of resistance to treatment.
25428364 The results suggests that a potential mechanism for the role of RuvBL1-RuvBL2 in maintaining genome integrity is through controlling the cellular abundance of Fanconi anaemia core complex.
More...

AA Sequence

MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAG      1 - 70
RAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEG     71 - 140
EVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFT    141 - 210
RARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKV    211 - 280
AEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDL    281 - 350
LDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE    351 - 420
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS                               421 - 463
//

Text Mined References (99)

PMID Year Title
26863765 2015 [DYNAMICS AND MECHANISMS OF INTERACTION OF HETERO-HEXAMERIC TIP49a/b COMPLEXES WITH DS-DNA].
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26303906 2015 RuvbL1 and RuvbL2 enhance aggresome formation and disaggregate amyloid fibrils.
26211835 2015 HIV-1 Exploits the Host Factor RuvB-like 2 to Balance Viral Protein Expression.
25957047 2015 Reptin physically interacts with p65 and represses NF-?B activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25875766 2015 Reptin regulates DNA double strand breaks repair in human hepatocellular carcinoma.
25652260 2015 Genome-wide screen identifies a novel p97/CDC-48-dependent pathway regulating ER-stress-induced gene transcription.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25437307 2014 LINKIN, a new transmembrane protein necessary for cell adhesion.
More...