Property Summary

NCBI Gene PubMed Count 91
PubMed Score 93.12
PubTator Score 76.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.3e-07
colon cancer 1478 9.5e-06
osteosarcoma 7950 8.4e-04
diabetes mellitus 1728 1.0e-03
Multiple myeloma 1332 2.1e-03
lung cancer 4740 3.8e-03
non primary Sjogren syndrome sicca 891 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.079 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 1.600 9.5e-06
diabetes mellitus -1.500 1.0e-03
lung cancer 1.300 3.8e-03
Multiple myeloma 1.085 2.1e-03
non primary Sjogren syndrome sicca 1.100 4.5e-02
osteosarcoma -1.199 8.4e-04
ovarian cancer 2.300 3.3e-07

Gene RIF (49)

AA Sequence

MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAG      1 - 70
RAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEG     71 - 140
EVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFT    141 - 210
RARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKV    211 - 280
AEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDL    281 - 350
LDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE    351 - 420
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS                               421 - 463
//

Text Mined References (105)

PMID Year Title