Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.66
PubTator Score 3.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.500 7.9e-04
Astrocytoma, Pilocytic 1.500 9.1e-07
colon cancer -1.800 4.9e-02
cutaneous lupus erythematosus 2.100 7.5e-04
ductal carcinoma in situ 1.300 1.7e-02
gastric cancer 1.600 2.2e-03
head and neck cancer -1.100 2.4e-02
hepatocellular carcinoma 1.300 1.3e-03
interstitial cystitis 2.000 6.3e-03
intraductal papillary-mucinous carcinoma... -1.400 1.0e-02
lung cancer -1.400 3.5e-03
lung carcinoma -1.600 3.3e-20
osteosarcoma -3.060 9.1e-06
pancreatic cancer 1.200 1.4e-02
pancreatic carcinoma 1.200 1.4e-02
primary Sjogren syndrome 1.400 3.8e-03
psoriasis 1.100 3.7e-05
sarcoidosis 1.100 3.1e-02
tuberculosis 1.700 4.7e-05
ulcerative colitis 1.400 4.9e-03
Waldenstrons macroglobulinemia -1.353 1.7e-02

Gene RIF (5)

AA Sequence

MISPDPRPSPGLARWAESYEAKCERRQEIRESRRCRPNVTTCRQVGKTLRIQQREQLQRARLQQFFRRRN      1 - 70
LELEEKGKAQHPQAREQGPSRRPGQVTVLKEPLSCARRISSPREQVTGTSSEVFPAQHPPPSGICRDLSD     71 - 140
HLSSQAGGLPPQDTPIKKPPKHHRGTQTKAEGPTIKNDASQQTNYGVAVLDKEIIQLSDYLKEALQRELV    141 - 210
LKQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYE    211 - 280
QKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKL    281 - 350
QGADSRDLQMNQALRFLENEHQQLQAKIECLQGDRDLCSLDTQDLQDQLKRSEAEKLTLVTRVQQLQGLL    351 - 420
QNQSLQLQEQEKLLTKKDQALPVWSPKSFPNEVEPEGTGKEKDWDLRDQLQKKTLQLQAKEKECRELHSE    421 - 490
LDNLSDEYLSCLRKLQHCREELNQSQQLPPRRQCGRWLPVLMVVIAAALAVFLANKDNLMI             491 - 551
//

Text Mined References (14)

PMID Year Title