Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.25
PubTator Score 10.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.215 0.000
psoriasis 1.200 0.001

Synonym

Accession Q9Y226 B2RCV9 Q8IYG1
Symbols OAT10
OCTL1
OCTL3
ORCTL3
ORCTL-3

Gene

Gene RIF (7)

PMID Text
25001539 Since ORCTL3 targets fatty acid metabolism in transformed cells and induces an ER stress specifically in these cells, it reveals a novel therapeutic interference option for tumor cells.
24769897 An adenovirus expressing ORCTL3 leads to growth inhibition of renal tumours in vivo and to substantial destruction of patients' kidney tumour cells ex vivo
24147638 Expression of SLC22A13 stimulates efflux of aspartate and glutamate at the basolateral membrane in renal collecting duct.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536068 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19282870 ORCTL3 protein causes cell death in v-src-transformed cells and in various human tumor cell lines but not in normal cells or untransformed cell lines.
18411268 SLC22A13 is a new urate and high affinity nicotinate transporter

AA Sequence

MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVL      1 - 70
SVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDTT     71 - 140
QSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGLSFSNV    141 - 210
TLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAYGFRNWRLLQITGTAPGLLLFFYFWALPESARWLLT    211 - 280
RGRMDEAIQLIQKAASVNRRKLSPELMNQLVPEKTGPSGNALDLFRHPQLRKVTLIIFCVWFVDSLGYYG    281 - 350
LSLQVGDFGLDVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTM    351 - 420
LAVVGKMATAAAFTISYVYSAELFPTILRQTGMGLVGIFSRIGGILTPLVILLGEYHAALPMLIYGSLPI    421 - 490
VAGLLCTLLPETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTYF             491 - 551
//

Text Mined References (16)

PMID Year Title
25001539 2014 Isolation and characterization of the anticancer gene organic cation transporter like-3 (ORCTL3).
24769897 2015 The anticancer gene ORCTL3 targets stearoyl-CoA desaturase-1 for tumour-specific apoptosis.
24147638 2014 SLC22A13 catalyses unidirectional efflux of aspartate and glutamate at the basolateral membrane of type A intercalated cells in the renal collecting duct.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19536068 2009 The effects of genetic polymorphisms in the organic cation transporters OCT1, OCT2, and OCT3 on the renal clearance of metformin.
19282870 2009 Isolation of ORCTL3 in a novel genetic screen for tumor-specific apoptosis inducers.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18411268 2008 Identification of a new urate and high affinity nicotinate transporter, hOAT10 (SLC22A13).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...