1. Home
  2. Targets
  3. RING finger protein 24

Tbio RING finger protein 24

May play a role in TRPCs intracellular trafficking.

This gene encodes an integral membrane protein that contains a RING-type zinc finger. The encoded protein may interact with multiple transient receptor potential cation channel subfamily C (TRPC) proteins and regulate the trafficking and insertion of these proteins into the plasma membrane. [provided by RefSeq, Mar 2016]

 Comments

Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.05
PubTator Score 7.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.36045132474563E-15
psoriasis 6685 1.67066324795114E-9
malignant mesothelioma 3163 6.07450110250475E-8
Breast cancer 3099 8.70608878947369E-8
pituitary cancer 1972 2.45128509754241E-4
atypical teratoid / rhabdoid tumor 4369 3.59723740572465E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.3418294329117E-4
glioblastoma 5572 4.93824940708168E-4
oligodendroglioma 2849 8.00878028338447E-4
primitive neuroectodermal tumor 3031 0.0013122492250018
medulloblastoma 1524 0.00282769543354735
active ulcerative colitis 477 0.00300291052316088
lung cancer 4473 0.00324141994126203
gastric carcinoma 832 0.00701114582641318
invasive ductal carcinoma 2950 0.0108310118980184
astrocytic glioma 2241 0.0163063253545851
medulloblastoma, large-cell 6234 0.0176413368128821
osteosarcoma 7933 0.031841814943987

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
astrocytic glioma 1.200 0.016
oligodendroglioma 1.200 0.001
psoriasis -1.400 0.000
osteosarcoma -1.281 0.032
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma 1.100 0.000
medulloblastoma -1.300 0.003
medulloblastoma, large-cell -1.200 0.018
primitive neuroectodermal tumor 1.100 0.001
non-small cell lung cancer 1.046 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.000
lung cancer 1.100 0.003
active ulcerative colitis 1.327 0.003
Breast cancer 1.300 0.000
gastric carcinoma 1.400 0.007
invasive ductal carcinoma 1.200 0.011
pituitary cancer -1.300 0.000

Synonym

Accession Q9Y225 D3DVZ2 D3DVZ3 Q9UMH1
Symbols G1L

Gene

RNF24

PDB

2EP4  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 GO Function (2)

 GO Component (2)

 GO Process (3)

 Compartment GO Term (23)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (1)

 UniProt Keyword (11)

See all...

Gene RIF (1)

PMID Text
17850865 Results indicate that RNF24 interacts with TRPC cation channels in the Golgi apparatus and affects TRPC intracellular trafficking without affecting their activity.

AA Sequence 

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVK      1 - 70
ELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGP     71 - 140
LPGAENIV                                                                  141 - 148
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17850865 2008 RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.