Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.05
PubTator Score 7.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
astrocytic glioma 1.200 0.016
oligodendroglioma 1.200 0.001
psoriasis -1.400 0.000
osteosarcoma -1.281 0.032
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma 1.100 0.000
medulloblastoma -1.300 0.003
medulloblastoma, large-cell -1.200 0.018
primitive neuroectodermal tumor 1.100 0.001
non-small cell lung cancer 1.046 0.000
intraductal papillary-mucinous neoplasm ... 1.700 0.000
lung cancer 1.100 0.003
active ulcerative colitis 1.327 0.003
Breast cancer 1.300 0.000
gastric carcinoma 1.400 0.007
invasive ductal carcinoma 1.200 0.011
pituitary cancer -1.300 0.000

Synonym

Accession Q9Y225 D3DVZ2 D3DVZ3 Q9UMH1
Symbols G1L

Gene

PDB

2EP4  

Gene RIF (1)

PMID Text
17850865 Results indicate that RNF24 interacts with TRPC cation channels in the Golgi apparatus and affects TRPC intracellular trafficking without affecting their activity.

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVK      1 - 70
ELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGP     71 - 140
LPGAENIV                                                                  141 - 148
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17850865 2008 RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.