Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.05
PubTator Score 7.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis 1.033 6.6e-03
astrocytic glioma 1.200 1.6e-02
atypical teratoid / rhabdoid tumor -1.200 3.6e-04
Breast cancer 1.300 8.7e-08
gastric carcinoma 1.300 1.2e-02
glioblastoma 1.100 4.9e-04
group 4 medulloblastoma -1.200 4.1e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.0e-03
invasive ductal carcinoma 1.100 8.4e-04
lung cancer 1.100 3.2e-03
malignant mesothelioma -1.300 1.3e-05
medulloblastoma, large-cell -1.200 1.8e-02
non-small cell lung cancer 1.046 2.4e-15
oligodendroglioma 1.200 8.0e-04
osteosarcoma -1.281 3.2e-02
pituitary cancer -1.200 3.9e-03
primitive neuroectodermal tumor 1.100 1.3e-03
psoriasis -1.400 1.7e-09

Gene RIF (1)

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVK      1 - 70
ELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGP     71 - 140
LPGAENIV                                                                  141 - 148
//

Text Mined References (6)

PMID Year Title