Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.18
PubTator Score 27.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.057 0.003
Multiple myeloma 1.014 0.005
lung cancer 1.500 0.000
diabetes mellitus -1.200 0.001
Breast cancer 2.600 0.025
ovarian cancer -1.900 0.000

Synonym

Accession Q9Y224
Symbols CLE
CLE7
CGI99
RLLM1
hCLE1
CGI-99
LCRP369

Gene

Gene RIF (9)

PMID Text
26905879 C14orf166 promotes bladder cancer cell proliferation and can be a novel prognostic biomarker for patients with bladder cancer.
26883017 C14orf166 could be a novel prognostic biomarker of breast cancer, it also contributes to cell proliferation by regulating G1/S transition.
25964093 Overexpression of chromosome 14 open reading frame 166 correlates with disease progression in nasopharyngeal carcinoma.
24608264 hCLE/C14orf166 associates with DDX1, HSPC117, and FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
22174317 HIV-1 Rev interacting protein, chromosome 14 open reading frame 166 (C14orf166), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with C14orf166 is increased by RRE
21900157 Silencing of CLE causes reduction of influenza A virus polymerase activity, viral RNA transcription and replication, virus titer, and viral particle production.
21823664 spatial interactions of hnRNPH1, NF45, and C14orf166 with HCVc174 likely modulate HCV or cellular functions during acute and chronic HCV infection
19152423 c14orf166 was identified asa novel metastasis-associated protein, and the roles of radixin, moesin and c14orf166 in pancreatic cancer metastasis deserve further investigations.
15147888 A novel protein CGI-99 is isolated, which may be involved in the functional regulation of human ninein in the centrosome structure and may also be important in brain development and tumorigenesis.

AA Sequence

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP      1 - 70
FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL     71 - 140
LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE    141 - 210
ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR                                        211 - 244
//

Text Mined References (26)

PMID Year Title
26905879 2016 C14orf166 is a high-risk biomarker for bladder cancer and promotes bladder cancer cell proliferation.
26883017 2016 C14orf166 overexpression correlates with tumor progression and poor prognosis of breast cancer.
26219895 2016 C14ORF166 overexpression is associated with pelvic lymph node metastasis and poor prognosis in uterine cervical cancer.
25964093 2015 Overexpression of chromosome 14 open reading frame 166 correlates with disease progression and poorer prognosis in human NPC.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
24608264 2014 hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...