Property Summary

NCBI Gene PubMed Count 25
PubMed Score 25.99
PubTator Score 11.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 4.3e-07
Pick disease 1894 2.9e-06
progressive supranuclear palsy 676 7.6e-03
ependymoma 4679 1.6e-02
astrocytic glioma 2597 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mood disorder 14 0.0 1.7
Disease Target Count Z-score Confidence
Dental caries 164 4.489 2.2
Dental fluorosis 20 4.185 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.400 2.0e-02
ependymoma 1.200 1.6e-02
ovarian cancer -1.400 4.3e-07
Pick disease -1.600 2.9e-06
progressive supranuclear palsy -1.400 7.6e-03

Gene RIF (11)

AA Sequence

MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPC      1 - 70
ISVVALPLSENDQSFEVTMTATTEVADDEVTEGTVTQIQILQNEQLDEISPLGNEEVSAVSQAWFTTKED     71 - 140
KDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAV    141 - 210
YRRVLRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEE    211 - 280
EKRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILR    281 - 350
IAELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFPVLIKGLKQLHENQKNNPTLL    351 - 420
ENKSGSGVPNSNTNSSVQHVQIRVARLEDNTAISSSPMAALQIPVQITHVSSADSPATVDSETITLNSGT    421 - 490
LQTFEILPSFHLQPTGTPGTYLLQTSSSQGLPLTLTASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDN    491 - 560
VTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDA    561 - 630
HVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVP    631 - 700
SPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH              701 - 760
//

Text Mined References (27)

PMID Year Title