Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.68
PubTator Score 8.54

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
glioblastoma 5572 1.13168045275278E-5
pediatric high grade glioma 2712 3.76474562516834E-5
medulloblastoma, large-cell 6234 6.20771536861813E-5
sonic hedgehog group medulloblastoma 1482 6.41052305433008E-5
ovarian cancer 8492 9.64423298526777E-4
lung cancer 4473 0.00408396087170819
Disease Target Count Z-score Confidence
Shwachman-Diamond syndrome 16 5.184 2.6


  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.400 0.000
lung cancer 1.100 0.004
pediatric high grade glioma 1.200 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
ovarian cancer 1.600 0.001


Accession Q9Y221 B2RD04 Q9NZZ0
Symbols KD93



1SQW   1T5Y  

  Ortholog (12)

 GO Function (1)

Gene RIF (5)

23166591 Expression of HIV-1 Tat upregulates the abundance of nuclear import 7 homolog (NIP7) in the nucleoli of Jurkat T-cells
22195017 The results presented in this work indicate a close functional interaction between NIP7 and FTSJ3 during pre-rRNA processing and show that FTSJ3 participates in ribosome synthesis in human cells.
20798176 Downregulation of NIP7 affects pre-rRNA processing, causing an imbalance of the 40S/60S subunit ratio.
17643419 SBDS is found in complexes containing the human Nip7 ortholog.
15522784 KD93 is a novel protein expressed in human hematopoietic stem/progenitor cells

AA Sequence

LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT                                  141 - 180

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22195017 2011 The human nucleolar protein FTSJ3 associates with NIP7 and functions in pre-rRNA processing.
21269460 2011 Initial characterization of the human central proteome.
20798176 2011 The NIP7 protein is required for accurate pre-rRNA processing in human cells.
17643419 2007 The Shwachman-Bodian-Diamond syndrome associated protein interacts with HsNip7 and its down-regulation affects gene expression at the transcriptional and translational levels.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.