Property Summary

NCBI Gene PubMed Count 53
Grant Count 120
R01 Count 76
Funding $9,884,520.97
PubMed Score 311.79
PubTator Score 161.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.600 0.000
psoriasis -1.100 0.000
colon cancer 1.400 0.010
posterior fossa group B ependymoma -1.100 0.000
sonic hedgehog group medulloblastoma -1.100 0.004
Breast cancer -1.100 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q9Y219 Q9UE17 Q9UE99 Q9UNK8 Q9Y6P9 Q9Y6Q0 Jagged2
Symbols HJ2
SER2

Gene

Gene RIF (33)

PMID Text
26412454 Jagged-2 enhances immunomodulatory activity in adipose derived mesenchymal stem cells
25576913 Increased expression of JAG2, a target of miR-1280, is associated with high metastatic dissemination at diagnosis and a poor outcome in medulloblastoma.
25351917 Results show that tumor cell migration, invasion, and metastasis are dependent on JAGGED2 independently of NOTCH activation.
25257302 silencing prevents Notch2-driven osteoclast development and bone destruction in multiple myeloma
24907271 Although Jag1 shares a high degree of homology with Jag2 in the ectodomain region, BACE1 fails to cleave Jag2 effectively, indicating a selective cleavage of Jag1.
24708907 This study demonistrated that NOTCH ligands JAG1 and JAG2 as critical pro-survival factors in childhood medulloblastoma.
24228105 Jagged2 expression status was closely correlated with important histopathologic characteristics (grades and stages) and the recurrence and metastasis of bladder urothelial carcinomas.
23074278 JAG2-mediated Notch activation confers phenotypic and functional aspects of Langerhans cell histiocytosis to dendritic cells.
22691042 Immunohistochemistry showed a reverse correlation between MUC2 and Notch3 or Jagged1 (P = 0.033 and P = 0.005, respectively) and between MUC5AC and Jagged1 or Hes1
22341562 JAG2 is often expressed by CD138(+) primary cells. Our results indicate that spontaneous clonogenic growth of myeloma cells requires the expression of JAG2.
More...

AA Sequence

MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTY      1 - 70
VRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPR     71 - 140
SFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF    141 - 210
CRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYP    211 - 280
GCVHGSCVEPWQCNCETNWGGLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHA    281 - 350
CTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC    351 - 420
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRGF    421 - 490
GGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYC    491 - 560
ACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTG    561 - 630
TYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCAC    631 - 700
DDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSG    701 - 770
ASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA    771 - 840
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKP    841 - 910
CLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHLDNNCARLTLHFNRD    911 - 980
HVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGAAHAIV    981 - 1050
AAITQRGNSSLLLAVTEVKVETVVTGGSSTGLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPR   1051 - 1120
EESANNQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDS   1121 - 1190
LEAEKFLSHKFTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE                         1191 - 1238
//

Text Mined References (54)

PMID Year Title
26412454 2015 Jagged-2 enhances immunomodulatory activity in adipose derived mesenchymal stem cells.
25576913 2015 A microRNA-1280/JAG2 network comprises a novel biological target in high-risk medulloblastoma.
25351917 2015 The NOTCH ligand JAGGED2 promotes pancreatic cancer metastasis independent of NOTCH signaling activation.
25257302 2014 Notch signaling drives multiple myeloma induced osteoclastogenesis.
25060200 2014 NOTCH1, NOTCH3, NOTCH4, and JAG2 protein levels in human endometrial cancer.
24907271 2014 ?-site amyloid precursor protein cleaving enzyme 1(BACE1) regulates Notch signaling by controlling the cleavage of Jagged 1 (Jag1) and Jagged 2 (Jag2) proteins.
24710391 2014 Crosstalk between miR-34a and Notch Signaling Promotes Differentiation in Apical Papilla Stem Cells (SCAPs).
24708907 2014 NOTCH ligands JAG1 and JAG2 as critical pro-survival factors in childhood medulloblastoma.
24670287 2014 Notch signaling genes: myogenic DNA hypomethylation and 5-hydroxymethylcytosine.
24605944 2014 Targeting BMP9-promoted human osteosarcoma growth by inactivation of notch signaling.
More...