Property Summary

NCBI Gene PubMed Count 24
PubMed Score 4.87
PubTator Score 7.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.4e-06
ovarian cancer 8520 5.9e-05
dermatomyositis 966 4.0e-03
astrocytic glioma 2597 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Centronuclear myopathy 27 4.56 2.3
Charcot-Marie-Tooth disease 62 3.75 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 1.5e-02
dermatomyositis 1.100 4.0e-03
osteosarcoma -1.900 7.4e-06
ovarian cancer -1.300 5.9e-05

Gene RIF (6)

AA Sequence

MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLALTTSGCPLVI      1 - 70
QCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSERLQGWQLIDLAEEYKRMGVP     71 - 140
NSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKFRSKGRFPVLSYYHQDKEAAICRCSQPLSGF    141 - 210
SARCLEDEHLLQAISKANPVNRYMYVMDTRPKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSS    211 - 280
LQKLLEVNGTKGLSVNDFYSGLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLG    281 - 350
SLLLDSYYRTIKGFMVLIEKDWISFGHKFSERCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA    351 - 420
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRFTVLEPNTVSF    421 - 490
NFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQRKNKQTDGILTKELLHSVHPE    491 - 560
SPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAEEFSKSEPAVVSLEYGVARMTC             561 - 621
//

Text Mined References (29)

PMID Year Title