Property Summary

NCBI Gene PubMed Count 22
PubMed Score 4.21
PubTator Score 7.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 7.35467714222619E-6
ovarian cancer 8492 5.9412047869666E-5
dermatomyositis 967 0.00398675767657251
astrocytic glioma 2241 0.0148824237464931
Disease Target Count Z-score Confidence
Centronuclear myopathy 21 4.565 2.3
Charcot-Marie-Tooth disease 74 3.768 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 0.015
osteosarcoma -1.900 0.000
ovarian cancer -1.300 0.000
dermatomyositis 1.100 0.004

Synonym

Gene

PANTHER Protein Class (2)

PDB

2YF0  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (6)

PMID Text
24591580 MTMR6, which dephosphorylates PI(3)P to PI, and its binding partner MTMR9, are required for macropinocytosis.
23188820 results indicate that the cellular localization of MTMR6 is regulated by Rab1B in the early secretory and autophagic pathways
19038970 MTMR9 greatly enhances the functions of MTMR6
16847315 Data show that KCa3.1, which is critical for Ca2+ influx in reactivated naive T cells and central memory T cells, requires phosphatidylinositol-3 phosphatase for activation and is inhibited by PI(3)P phosphatase myotubularin-related protein 6 (MTMR6).
12847286 Identification of myotubularin as the lipid phosphatase catalytic subunit associated with the 3-phosphatase adapter protein, 3-PAP.
12646134 investigation of MTM1 and MTMR6 and finding that they use PtdIns(3,5)P2 in addition to PtdIns3P as a substrate in vitro

AA Sequence

MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLALTTSGCPLVI      1 - 70
QCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSERLQGWQLIDLAEEYKRMGVP     71 - 140
NSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKFRSKGRFPVLSYYHQDKEAAICRCSQPLSGF    141 - 210
SARCLEDEHLLQAISKANPVNRYMYVMDTRPKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSS    211 - 280
LQKLLEVNGTKGLSVNDFYSGLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLG    281 - 350
SLLLDSYYRTIKGFMVLIEKDWISFGHKFSERCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA    351 - 420
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRFTVLEPNTVSF    421 - 490
NFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQRKNKQTDGILTKELLHSVHPE    491 - 560
SPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAEEFSKSEPAVVSLEYGVARMTC             561 - 621
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24591580 2014 Sequential breakdown of 3-phosphorylated phosphoinositides is essential for the completion of macropinocytosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23188820 2013 Phosphatidylinositol 3-phosphatase myotubularin-related protein 6 (MTMR6) is regulated by small GTPase Rab1B in the early secretory and autophagic pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19038970 2009 MTMR9 increases MTMR6 enzyme activity, stability, and role in apoptosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...