Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
R01 Count 2
Funding $614,265.66
PubMed Score 3.79
PubTator Score 1.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma multiforme -1.200 0.000
posterior fossa group A ependymoma -1.300 0.000
group 3 medulloblastoma -1.300 0.033
pediatric high grade glioma -1.200 0.000
lung carcinoma 4.400 0.000

Gene RIF (2)

PMID Text
22137330 The MTMR7 gene is linked to variant Creutzfeldt-Jakob risk in a genome-wide study.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDPRKETWILHSQISTIEKQATTATGCPL      1 - 70
LIRCKNFQIIQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPMLDKEEREQGWVLIDLSEEYTRMG     71 - 140
LPNHYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSSKFRSRRRFPVLSYYYKDNHASICRSSQPLS    141 - 210
GFSARCLEDEQMLQAIRKANPGSDFVYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMR    211 - 280
NSLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCS    281 - 350
VASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN    351 - 420
ERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHSQTQGTLHLPT    421 - 490
TPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEERLEKIQKVQLNCTKVKSKQS    491 - 560
EPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSANSDQESGVEDL    561 - 630
SCRSPSGGEHAPSEDSGKDRDSDEAVFLTA                                            631 - 660
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22137330 2012 Genome-wide study links MTMR7 gene to variant Creutzfeldt-Jakob risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16787938 2006 Systematic analysis of myotubularins: heteromeric interactions, subcellular localisation and endosome related functions.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12925573 2003 Myotubularins, a large disease-associated family of cooperating catalytically active and inactive phosphoinositides phosphatases.
More...