Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.79
PubTator Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 2.8e-67
ependymoma 4679 5.5e-06
glioblastoma 5792 2.8e-05
adult high grade glioma 3801 1.4e-02
group 3 medulloblastoma 4104 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Creutzfeldt-Jakob disease 21 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 1.4e-02
ependymoma -1.100 5.5e-06
glioblastoma -1.200 2.8e-05
group 3 medulloblastoma -1.300 3.3e-02
lung carcinoma 4.400 2.8e-67

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDPRKETWILHSQISTIEKQATTATGCPL      1 - 70
LIRCKNFQIIQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPMLDKEEREQGWVLIDLSEEYTRMG     71 - 140
LPNHYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSSKFRSRRRFPVLSYYYKDNHASICRSSQPLS    141 - 210
GFSARCLEDEQMLQAIRKANPGSDFVYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMR    211 - 280
NSLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCS    281 - 350
VASLLLDPHYRTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN    351 - 420
ERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHSQTQGTLHLPT    421 - 490
TPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEERLEKIQKVQLNCTKVKSKQS    491 - 560
EPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSANSDQESGVEDL    561 - 630
SCRSPSGGEHAPSEDSGKDRDSDEAVFLTA                                            631 - 660
//

Text Mined References (15)

PMID Year Title